Mouse anti-Human MED1 Monoclonal Antibody | anti-MED1 antibody

MED1 (Mediator of RNA Polymerase II Transcription Subunit 1, Activator-recruited Cofactor 205kD Component, ARC205, Mediator Complex Subunit 1, Peroxisome Proliferator-activated Receptor-binding Protein, PBP, PPAR-binding Protein, Thyroid Hormone Receptor-

Cat. Num. AAA6158785

• Gene Names: MED1; PBP; CRSP1; RB18A; TRIP2; PPARBP; CRSP200; DRIP205; DRIP230; PPARGBP; TRAP220
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MED1; Monoclonal Antibody; MED1 (Mediator of RNA Polymerase II Transcription Subunit 1; Activator-recruited Cofactor 205kD Component; ARC205; Mediator Complex Subunit 1; Peroxisome Proliferator-activated Receptor-binding Protein; PBP; PPAR-binding Protein; Thyroid Hormone Receptor-; anti-MED1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A2
• Specificity: Recognizes human PPARBP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1581

• Applicable Applications for anti-MED1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1391-1491 from human PPARBP (NP_004765) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of PPARBP expression in transfected 293T cell line by PPARBP monoclonal antibody. Lane 1: PPARBP transfected lysate (61.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PPARBP on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PPARBP is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-MED1 antibody

Antibodies; Obesity Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 28559039
• NCBI GeneID: 5469
• NCBI Accession #: NP_004765
• NCBI GenBank Nucleotide #: NM_004774
• UniProt Accession #: Q15648
• NCBI Official Full Name: mediator of RNA polymerase II transcription subunit 1
• NCBI Official Synonym Full Names: mediator complex subunit 1
• NCBI Official Symbol: MED1
• NCBI Official Synonym Symbols: PBP; CRSP1; RB18A; TRIP2; PPARBP; CRSP200; DRIP205; DRIP230; PPARGBP; TRAP220
• NCBI Protein Information: mediator of RNA polymerase II transcription subunit 1
• UniProt Protein Name: Mediator of RNA polymerase II transcription subunit 1
• Protein Family: Mediator of RNA polymerase II transcription
• UniProt Gene Name: MED1
• UniProt Synonym Gene Names: ARC205; CRSP1; CRSP200; DRIP205; DRIP230; PBP; PPARBP; PPARGBP; RB18A; TRAP220; TRIP2; ARC205; PBP; PPAR-binding protein; Trap220; TR-interacting protein 2; TRIP-2
• UniProt Entry Name: MED1_HUMAN

NCBI Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. [provided by RefSeq, Jul 2008]

Uniprot Description

MED1: a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. Also is a component of other multisubunit complexes e.g. thyroid hormone receptor- (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. May regulates p53-dependent apoptosis. Is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: nucleoplasm; membrane; nucleolus; Srb-mediator complex; nucleus; chromatin

Molecular Function: ligand-dependent nuclear receptor binding; peroxisome proliferator activated receptor binding; retinoic acid receptor binding; chromatin DNA binding; transcription coactivator activity; receptor activity; transcription factor binding; thyroid hormone receptor coactivator activity; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; vitamin D receptor binding; transcription cofactor activity; LBD domain binding; estrogen receptor binding; chromatin binding; thyroid hormone receptor binding; nuclear hormone receptor binding

Biological Process: fat cell differentiation; lactation; lens development in camera-type eye; embryonic placenta development; erythrocyte development; regulation of cell cycle; positive regulation of transcription, DNA-dependent; positive regulation of estrogen receptor signaling pathway; positive regulation of mammary gland epithelial cell proliferation; cell morphogenesis; enucleate erythrocyte development; negative regulation of transcription from RNA polymerase II promoter; cellular lipid metabolic process; androgen biosynthetic process; embryonic hindlimb morphogenesis; angiogenesis; positive regulation of keratinocyte differentiation; steroid hormone receptor signaling pathway; transcription initiation from RNA polymerase II promoter; regulation of transcription from RNA polymerase I promoter; organ regeneration; positive regulation of protein import into nucleus, translocation; monocyte differentiation; embryonic hemopoiesis; thyroid hormone generation; liver development; mRNA transcription from RNA polymerase II promoter; keratinocyte differentiation; negative regulation of neuron differentiation; androgen receptor signaling pathway; embryonic heart tube development; gene expression; positive regulation of transcription from RNA polymerase II promoter; brain development; negative regulation of apoptosis