Mouse MECP2 Monoclonal Antibody | anti-MECP2 antibody

MECP2 (Methyl-CpG-binding Protein 2, MeCp-2 Protein, MeCp2, DKFZp686A24160) (PE)

Cat. Num. AAA6158784

• Gene Names: MECP2; RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MECP2; Monoclonal Antibody; MECP2 (Methyl-CpG-binding Protein 2; MeCp-2 Protein; MeCp2; DKFZp686A24160) (PE); anti-MECP2 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B6
• Specificity: Recognizes human MECP2. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MECP2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa81-170 from human MECP2 (AAH11612) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(MECP2 monoclonal antibody. Western Blot analysis of MECP2 expression in rat muscle.)

Western Blot (WB)

(MECP2 monoclonal antibody Western Blot analysis of MECP2 expression in MCF-7,)

Western Blot (WB)

(MECP2 monoclonal antibody. Western Blot analysis of MECP2 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of MECP2 expression in transfected 293T cell line by MECP2 monoclonal antibody. Lane 1: MECP2 transfected lysate (52.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MECP2 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-MECP2 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15079579
• NCBI GeneID: 4204
• Molecular Weight: 53,323 Da
• NCBI Official Full Name: Homo sapiens methyl CpG binding protein 2 (Rett syndrome), mRNA
• NCBI Official Synonym Full Names: methyl CpG binding protein 2
• NCBI Official Symbol: MECP2
• NCBI Official Synonym Symbols: RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13
• NCBI Protein Information: methyl-CpG-binding protein 2; meCp-2 protein
• Protein Family: Methyl-CpG-binding protein

NCBI Description

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. [provided by RefSeq, Jul 2009]