Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ITGA6 Monoclonal Antibody | anti-ITGA6 antibody

ITGA6 (Integrin alpha-6, VLA-6, CD49 Antigen-like Family Member F, CD49f, DKFZp686J01244, FLJ18737) (PE)

Gene Names
ITGA6; CD49f; VLA-6; ITGA6B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITGA6; Monoclonal Antibody; ITGA6 (Integrin alpha-6; VLA-6; CD49 Antigen-like Family Member F; CD49f; DKFZp686J01244; FLJ18737) (PE); anti-ITGA6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C1
Specificity
Recognizes human ITGA6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ITGA6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-133 from human ITGA6 (NP_000201) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRGEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged ITGA6 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ITGA6 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-ITGA6 antibody
Integrins are a family of heterodimeric membrane glycoproteins consisting on non-covalently associated alpha and beta subunits. In general, integrins function as receptors for extracellular matrix proteins.
Product Categories/Family for anti-ITGA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
122,358 Da
NCBI Official Full Name
integrin alpha-6 isoform b
NCBI Official Synonym Full Names
integrin, alpha 6
NCBI Official Symbol
ITGA6
NCBI Official Synonym Symbols
CD49f; VLA-6; ITGA6B
NCBI Protein Information
integrin alpha-6; CD49 antigen-like family member F; integrin alpha6B
UniProt Protein Name
Integrin alpha-6
Protein Family
UniProt Gene Name
ITGA6
UniProt Entry Name
ITA6_HUMAN

Uniprot Description

ITGA6: Integrin alpha-6/beta-1 is a receptor for laminin on platelets. Integrin alpha-6/beta-4 is a receptor for laminin in epithelial cells and it plays a critical structural role in the hemidesmosome. Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-6 associates with either beta-1 or beta-4. Interacts with HPS5. Interacts with RAB21. Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoforms containing segment X1 are ubiquitously expressed. Isoforms containing segment X1X2 are expressed in heart, kidney, placenta, colon, duodenum, myoblasts and myotubes, and in a limited number of cell lines; they are always coexpressed with the ubiquitous isoform containing segment X1. In some tissues (e.g. Salivary gland), isoforms containing cytoplasmic segment A and isoforms containing segment B are detected while in others, only isoforms containing one cytoplasmic segment are found (segment A in epidermis and segment B in kidney). Belongs to the integrin alpha chain family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Receptor, misc.; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: cell surface; cell-cell adherens junction; focal adhesion; hemidesmosome; plasma membrane; basal plasma membrane; basement membrane; filopodium; external side of plasma membrane

Molecular Function: integrin binding; protein binding; metal ion binding; laminin binding

Biological Process: integrin-mediated signaling pathway; skin development; extracellular matrix organization and biogenesis; filopodium formation; positive regulation of apoptosis; cell-matrix adhesion; cell-substrate adhesion; cell-cell adhesion; hemidesmosome assembly; gut development; cellular response to extracellular stimulus; brown fat cell differentiation; positive regulation of cell-cell adhesion; cell-substrate junction assembly; cell adhesion mediated by integrin; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; leukocyte migration; positive regulation of phosphorylation

Disease: Epidermolysis Bullosa Junctionalis With Pyloric Atresia

Similar Products

Product Notes

The ITGA6 itga6 (Catalog #AAA6158431) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGA6 (Integrin alpha-6, VLA-6, CD49 Antigen-like Family Member F, CD49f, DKFZp686J01244, FLJ18737) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITGA6 itga6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGA6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.