Mouse anti-Human CD20 Monoclonal Antibody | anti-CD20 antibody

CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (PE)

Cat. Num. AAA6156950

• Gene Names: MS4A1; B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD20; Monoclonal Antibody; CD20 (B1; B-lymphocyte Antigen CD20; B-lymphocyte Surface Antigen B1; Bp35; CVID5; Leukocyte Surface Antigen Leu-16; LEU-16; Membrane-spanning 4-domains Subfamily A Member 1; MS4A1; MS4A2; MGC3969; S7) (PE); anti-CD20 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5C11
• Specificity: Recognizes human MS4A1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CD20 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa210-297 from human MS4A1 (AAH02807) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.42kD).)

Western Blot (WB)

(MS4A1 monoclonal antibody, Western Blot analysis of MS4A1 expression in HeLa NE.)

Testing Data

(Detection limit for recombinant GST tagged MS4A1 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-CD20 antibody

Members of MS4A protein family are characterized by the presence of 4 highly conserved transmembrane domains. CD20, a 35-37kD Human B-cell specific tetraspan membrane protein, is a unique member of this family. CD20 plays a major role in the initiation of intracellular signaling and regulating B-cell growth and differentiation. It complexes with BCR and regulates Calcium ion entry, thereby regulating B-cell signaling and activation. Antibodies such as Rituximab directed against CD20 are being extensively used for the treatment of B-cell lymphomas.

Product Categories/Family for anti-CD20 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 33877203
• NCBI GeneID: 931
• Molecular Weight: 14,581 Da
• NCBI Official Full Name: Homo sapiens membrane-spanning 4-domains, subfamily A, member 1, mRNA
• NCBI Official Synonym Full Names: membrane spanning 4-domains A1
• NCBI Official Symbol: MS4A1
• NCBI Official Synonym Symbols: B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16
• NCBI Protein Information: B-lymphocyte antigen CD20
• Protein Family: CD209 antigen

NCBI Description

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq, Jul 2008]