Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human BLMH Monoclonal Antibody | anti-BLMH antibody

BLMH (Bleomycin Hydrolase, BH, BLM Hydrolase, BMH) (PE)

Gene Names
BLMH; BH; BMH
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BLMH; Monoclonal Antibody; BLMH (Bleomycin Hydrolase; BH; BLM Hydrolase; BMH) (PE); anti-BLMH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A2
Specificity
Recognizes human BLMH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BLMH antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa356-455 from human BLMH (NP_000377) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(BLMH monoclonal antibody. Western Blot analysis of BLMH expression in K-562.)

Western Blot (WB) (BLMH monoclonal antibody. Western Blot analysis of BLMH expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged BLMH is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BLMH is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-BLMH antibody
BLMH is a member of the peptidase C1 family and exists as a homohexamer. While its normal physiological function is not known, it protects normal and malignant cells from the glycopeptide antitumor drug BLM. It inactivates bleomycin B2 (a cytotoxic glycometallopeptide) by hydrolysis of a carboxyamide bond of beta-aminoalanine and also shows general aminopeptidase activity. The specificity varies but amino acid arylamides of Met, Leu and Ala are preferred.
Product Categories/Family for anti-BLMH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
642
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54.7 kDa (475aa), confirmed by MALDI-TOF
NCBI Official Full Name
bleomycin hydrolase
NCBI Official Synonym Full Names
bleomycin hydrolase
NCBI Official Symbol
BLMH
NCBI Official Synonym Symbols
BH; BMH
NCBI Protein Information
bleomycin hydrolase
UniProt Protein Name
Bleomycin hydrolase
Protein Family
UniProt Gene Name
BLMH
UniProt Synonym Gene Names
BH; BLM hydrolase; BMH
UniProt Entry Name
BLMH_HUMAN

NCBI Description

Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. [provided by RefSeq, Jul 2008]

Uniprot Description

BLMH: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. Belongs to the peptidase C1 family.

Protein type: EC 3.4.22.40; Protease

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; carboxypeptidase activity; cysteine-type endopeptidase activity; aminopeptidase activity; cysteine-type peptidase activity

Biological Process: response to drug; antigen processing and presentation of peptide antigen via MHC class I; protein polyubiquitination; response to toxin; proteolysis

Disease: Alzheimer Disease

Research Articles on BLMH

Similar Products

Product Notes

The BLMH blmh (Catalog #AAA6156739) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BLMH (Bleomycin Hydrolase, BH, BLM Hydrolase, BMH) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BLMH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BLMH blmh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BLMH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.