Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between SMARCB1 and BAZ1B HeLa cells were stained with SMARCB1 rabbit purified polyclonal 1:1200 and BAZ1B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Mouse anti-Human BAZ1B Monoclonal Antibody | anti-BAZ1B antibody

BAZ1B (WBSC10, WBSCR10, WBSCR9, WSTF, Tyrosine-protein Kinase BAZ1B, Bromodomain Adjacent to Zinc Finger Domain Protein 1B, Williams Syndrome Transcription Factor, Williams-Beuren Syndrome Chromosomal Region 10 Protein, Williams-Beuren Syndrome Chromosoma

Gene Names
BAZ1B; WSTF; WBSCR9; WBSCR10
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAZ1B; Monoclonal Antibody; BAZ1B (WBSC10; WBSCR10; WBSCR9; WSTF; Tyrosine-protein Kinase BAZ1B; Bromodomain Adjacent to Zinc Finger Domain Protein 1B; Williams Syndrome Transcription Factor; Williams-Beuren Syndrome Chromosomal Region 10 Protein; Williams-Beuren Syndrome Chromosoma; anti-BAZ1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E9
Specificity
Recognizes human BAZ1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BAZ1B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1384-1484 from BAZ1B (NP_075381) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between SMARCB1 and BAZ1B HeLa cells were stained with SMARCB1 rabbit purified polyclonal 1:1200 and BAZ1B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between SMARCB1 and BAZ1B HeLa cells were stained with SMARCB1 rabbit purified polyclonal 1:1200 and BAZ1B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between SMARCB1 and BAZ1B. Huh7 cells were stained with SMARCB1 rabbit purified polyclonal 1:1200 and BAZ1B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between SMARCB1 and BAZ1B. Huh7 cells were stained with SMARCB1 rabbit purified polyclonal 1:1200 and BAZ1B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to BAZ1B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to BAZ1B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])
Product Categories/Family for anti-BAZ1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Synonym Full Names
bromodomain adjacent to zinc finger domain 1B
NCBI Official Symbol
BAZ1B
NCBI Official Synonym Symbols
WSTF; WBSCR9; WBSCR10
NCBI Protein Information
tyrosine-protein kinase BAZ1B
Protein Family

NCBI Description

This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008]

Research Articles on BAZ1B

Similar Products

Product Notes

The BAZ1B (Catalog #AAA6156704) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BAZ1B (WBSC10, WBSCR10, WBSCR9, WSTF, Tyrosine-protein Kinase BAZ1B, Bromodomain Adjacent to Zinc Finger Domain Protein 1B, Williams Syndrome Transcription Factor, Williams-Beuren Syndrome Chromosomal Region 10 Protein, Williams-Beuren Syndrome Chromosoma reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAZ1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAZ1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAZ1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.