Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human TWSG1 Monoclonal Antibody | anti-TWSG1 antibody

TWSG1 (Twisted Gastrulation Protein Homolog 1, TSG, PSEC0250) (HRP)

Gene Names
TWSG1; TSG
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TWSG1; Monoclonal Antibody; TWSG1 (Twisted Gastrulation Protein Homolog 1; TSG; PSEC0250) (HRP); anti-TWSG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
6E6
Specificity
Recognizes human TWSG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
223
Applicable Applications for anti-TWSG1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 0.1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa124-224 from human TWSG1 (NP_065699) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of TWSG1 expression in transfected 293T cell line by TWSG1 monoclonal antibody. Lane 1: TWSG1 transfected lysate (25kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TWSG1 expression in transfected 293T cell line by TWSG1 monoclonal antibody. Lane 1: TWSG1 transfected lysate (25kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TWSG1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TWSG1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-TWSG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
twisted gastrulation protein homolog 1
NCBI Official Synonym Full Names
twisted gastrulation BMP signaling modulator 1
NCBI Official Symbol
TWSG1
NCBI Official Synonym Symbols
TSG
NCBI Protein Information
twisted gastrulation protein homolog 1
UniProt Protein Name
Twisted gastrulation protein homolog 1
UniProt Gene Name
TWSG1
UniProt Synonym Gene Names
TSG
UniProt Entry Name
TWSG1_HUMAN

Uniprot Description

TWSG1: May be involved in dorsoventral axis formation. Seems to antagonize BMP signaling by forming ternary complexes with CHRD and BMPs, thereby preventing BMPs from binding to their receptors. In addition to the anti-BMP function, also has pro-BMP activity, partly mediated by cleavage and degradation of CHRD, which releases BMPs from ternary complexes. May be an important modulator of BMP-regulated cartilage development and chondrocyte differentiation. May play a role in thymocyte development. Belongs to the twisted gastrulation protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 18p11.3

Molecular Function: protein binding

Research Articles on TWSG1

Similar Products

Product Notes

The TWSG1 twsg1 (Catalog #AAA6155602) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TWSG1 (Twisted Gastrulation Protein Homolog 1, TSG, PSEC0250) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TWSG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 0.1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TWSG1 twsg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TWSG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.