Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TNRC6C Monoclonal Antibody | anti-TNRC6C antibody

TNRC6C (Trinucleotide Repeat-containing Gene 6C Protein, KIAA1582) (HRP)

Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TNRC6C; Monoclonal Antibody; TNRC6C (Trinucleotide Repeat-containing Gene 6C Protein; KIAA1582) (HRP); anti-TNRC6C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G11
Specificity
Recognizes human TNRC6C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1690
Applicable Applications for anti-TNRC6C antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa181-280 from human TNRC6C (NP_061869) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Categories/Family for anti-TNRC6C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
trinucleotide repeat-containing gene 6C protein isoform 2
NCBI Official Synonym Full Names
trinucleotide repeat containing adaptor 6C
NCBI Official Symbol
TNRC6C
NCBI Protein Information
trinucleotide repeat-containing gene 6C protein
UniProt Protein Name
Trinucleotide repeat-containing gene 6C protein
UniProt Gene Name
TNRC6C
UniProt Synonym Gene Names
KIAA1582
UniProt Entry Name
TNR6C_HUMAN

Uniprot Description

Function: Plays a role in RNA-mediated gene silencing by micro-RNAs (miRNAs). Required for miRNA-dependent translational repression of complementary mRNAs by argonaute family proteins. As scaffoldng protein associates with argonaute proteins bound to partially complementary mRNAs and simultaneously can recruit CCR4-NOT and PAN deadenylase complexes. Ref.8 Ref.11 Ref.12 Ref.13

Subunit structure: Interacts with one or more of the argonaute family proteins AGO1, AGO2, AGO3 and AGO4. Interacts with PABPC1 and EIF4G1. Interacts with CNOT1; the interaction is direct and mediates the association with the CCR4-NOT complex. Interacts with PAN3; the interaction mediates the association with the PAN complex. Ref.7 Ref.8 Ref.9 Ref.11 Ref.12 Ref.13

Domain: The silencing domain, also known as C-terminal effector domain (CED), can act in autonomous repression, including both translational inhibition and mRNA degradation.

Sequence similarities: Belongs to the GW182 family.Contains 1 RRM (RNA recognition motif) domain.Contains 1 UBA domain.

Sequence caution: The sequence BAB13408.2 differs from that shown. Reason: Erroneous initiation. The sequence BAB71179.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on TNRC6C

Similar Products

Product Notes

The TNRC6C tnrc6c (Catalog #AAA6155472) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TNRC6C (Trinucleotide Repeat-containing Gene 6C Protein, KIAA1582) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNRC6C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNRC6C tnrc6c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNRC6C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.