Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SLC15A1 Monoclonal Antibody | anti-SLC15A1 antibody

SLC15A1 (Solute Carrier Family 15 Member 1, Intestinal H(+)/Peptide Cotransporter, Oligopeptide Transporter, Small Intestine Isoform, Peptide Transporter 1, PEPT1) (HRP)

Gene Names
SLC15A1; PEPT1; HPECT1; HPEPT1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC15A1; Monoclonal Antibody; SLC15A1 (Solute Carrier Family 15 Member 1; Intestinal H(+)/Peptide Cotransporter; Oligopeptide Transporter; Small Intestine Isoform; Peptide Transporter 1; PEPT1) (HRP); anti-SLC15A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F8
Specificity
Recognizes human SLC15A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SLC15A1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa473-573 from human SLC15A1 (NP_005064) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged SLC15A1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC15A1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-SLC15A1 antibody
Proton-coupled intake of oligopeptides of 2 to 4aa with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products.
Product Categories/Family for anti-SLC15A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,806 Da
NCBI Official Full Name
solute carrier family 15 member 1
NCBI Official Synonym Full Names
solute carrier family 15 member 1
NCBI Official Symbol
SLC15A1
NCBI Official Synonym Symbols
PEPT1; HPECT1; HPEPT1
NCBI Protein Information
solute carrier family 15 member 1
UniProt Protein Name
Solute carrier family 15 member 1
Protein Family
UniProt Gene Name
SLC15A1
UniProt Synonym Gene Names
PEPT1
UniProt Entry Name
S15A1_HUMAN

NCBI Description

This gene encodes an intestinal hydrogen peptide cotransporter that is a member of the solute carrier family 15. The encoded protein is localized to the brush border membrane of the intestinal epithelium and mediates the uptake of di- and tripeptides from the lumen into the enterocytes. This protein plays an important role in the uptake and digestion of dietary proteins. This protein also facilitates the absorption of numerous peptidomimetic drugs. [provided by RefSeq, Apr 2010]

Uniprot Description

SLC15A1: Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products. Belongs to the PTR2/POT transporter (TC 2.A.17) family.

Protein type: Transporter; Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q32.3

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: proton-dependent oligopeptide secondary active transmembrane transporter activity; peptide:hydrogen symporter activity

Biological Process: proton transport; protein transport; transport; digestion; ion transport; transmembrane transport

Research Articles on SLC15A1

Similar Products

Product Notes

The SLC15A1 slc15a1 (Catalog #AAA6154995) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC15A1 (Solute Carrier Family 15 Member 1, Intestinal H(+)/Peptide Cotransporter, Oligopeptide Transporter, Small Intestine Isoform, Peptide Transporter 1, PEPT1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC15A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC15A1 slc15a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC15A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.