Mouse anti-Human ROR2 Monoclonal Antibody | anti-ROR2 antibody

ROR2 (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2, MGC163394) (HRP)

Cat. Num. AAA6154710

• Gene Names: ROR2; BDB; BDB1; NTRKR2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ROR2; Monoclonal Antibody; ROR2 (Tyrosine-protein Kinase Transmembrane Receptor ROR2; Neurotrophic Tyrosine Kinase; Receptor-related 2; NTRKR2; MGC163394) (HRP); anti-ROR2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E1
• Specificity: Recognizes human ROR2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ROR2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa34-144 from human ROR2 (NP_004551) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged ROR2 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-ROR2 antibody

ROR2 is a tyrosine-protein kinase receptor which may be involved in the early formation of the chondrocytes. It seems to be required for cartilage and growth plate development. This Type I membrane protein is expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues. Defects in ROR2 are a cause of brachydactyly type B1 (BDB1). BDB1 is an autosomal dominant skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In BDB1 the middle phalanges are short but in addition the terminal phalanges are rudimentary or absent. Both fingers and toes are affected. The thumbs and big toes are usually deformed. Defects in ROR2 are a cause of recessive Robinow syndrome (RRS). RRS is an autosomal disorder characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly and a dysmorphic facial appearance. The protein contains 1 frizzled (FZ) domain, 1 immunoglobulin-like C2-type domain, and 1 kringle domain.

Product Categories/Family for anti-ROR2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 19743898
• NCBI GeneID: 4920
• NCBI Accession #: NP_004551
• NCBI GenBank Nucleotide #: NM_004560
• UniProt Accession #: Q01974; Q59GF5; Q5SPI5; Q9HAY7; Q9HB61
• Molecular Weight: 104,757 Da
• NCBI Official Full Name: tyrosine-protein kinase transmembrane receptor ROR2
• NCBI Official Synonym Full Names: receptor tyrosine kinase-like orphan receptor 2
• NCBI Official Symbol: ROR2
• NCBI Official Synonym Symbols: BDB; BDB1; NTRKR2
• NCBI Protein Information: tyrosine-protein kinase transmembrane receptor ROR2; neurotrophic tyrosine kinase receptor-related 2
• UniProt Protein Name: Tyrosine-protein kinase transmembrane receptor ROR2
• UniProt Gene Name: ROR2
• UniProt Synonym Gene Names: NTRKR2
• UniProt Entry Name: ROR2_HUMAN

Uniprot Description

ROR2: a receptor tyrosine kinase of the ROR family. May be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance.

Protein type: Protein kinase, TK; Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); EC 2.7.10.1; TK group; Ror family

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: Wnt-protein binding; protein binding; frizzled binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: somitogenesis; inner ear morphogenesis; peptidyl-tyrosine phosphorylation; Wnt receptor signaling pathway, planar cell polarity pathway; multicellular organismal development; positive regulation of transcription, DNA-dependent; signal transduction; negative regulation of cell proliferation; Wnt receptor signaling pathway, calcium modulating pathway; JNK cascade; cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; cartilage condensation; embryonic genitalia morphogenesis; positive regulation of cell migration

Disease: Robinow Syndrome, Autosomal Recessive; Brachydactyly, Type B1