Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human RIN2 Monoclonal Antibody | anti-RIN2 antibody

RIN2 (Ras and Rab Interactor 2, MACS, Ras Association Domain Family 4, RASSF4, Ras Inhibitor JC265, Ras Interaction/interference Protein 2) (HRP)

Gene Names
RIN2; MACS; RASSF4
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RIN2; Monoclonal Antibody; RIN2 (Ras and Rab Interactor 2; MACS; Ras Association Domain Family 4; RASSF4; Ras Inhibitor JC265; Ras Interaction/interference Protein 2) (HRP); anti-RIN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E7
Specificity
Recognizes human RIN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
895
Applicable Applications for anti-RIN2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa786-895 from human RIN2 (NP_061866) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(RIN2 monoclonal antibody. Western Blot analysis of RIN2 expression in human liver.)

Western Blot (WB) (RIN2 monoclonal antibody. Western Blot analysis of RIN2 expression in human liver.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RIN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RIN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RIN2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RIN2 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-RIN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ras and Rab interactor 2 isoform 2
NCBI Official Synonym Full Names
Ras and Rab interactor 2
NCBI Official Symbol
RIN2
NCBI Official Synonym Symbols
MACS; RASSF4
NCBI Protein Information
ras and Rab interactor 2
UniProt Protein Name
Ras and Rab interactor 2
Protein Family
UniProt Gene Name
RIN2
UniProt Synonym Gene Names
RASSF4
UniProt Entry Name
RIN2_HUMAN

NCBI Description

The RAB5 protein is a small GTPase involved in membrane trafficking in the early endocytic pathway. The protein encoded by this gene binds the GTP-bound form of the RAB5 protein preferentially over the GDP-bound form, and functions as a guanine nucleotide exchange factor for RAB5. The encoded protein is found primarily as a tetramer in the cytoplasm and does not bind other members of the RAB family. Mutations in this gene cause macrocephaly alopecia cutis laxa and scoliosis (MACS) syndrome, an elastic tissue disorder, as well as the related connective tissue disorder, RIN2 syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011]

Research Articles on RIN2

Similar Products

Product Notes

The RIN2 rin2 (Catalog #AAA6154641) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RIN2 (Ras and Rab Interactor 2, MACS, Ras Association Domain Family 4, RASSF4, Ras Inhibitor JC265, Ras Interaction/interference Protein 2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RIN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RIN2 rin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RIN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.