Mouse anti-Human RHOT1 Monoclonal Antibody | anti-RHOT1 antibody

RHOT1 (Ras Homolog Gene Family Member T1, ARHT1, Mitochondrial Rho GTPase 1, MIRO1, MIRO-1, hMiro-1, Rac-GTP-binding Protein-like Protein) (HRP)

Cat. Num. AAA6154637

• Gene Names: RHOT1; ARHT1; MIRO1; MIRO-1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RHOT1; Monoclonal Antibody; RHOT1 (Ras Homolog Gene Family Member T1; ARHT1; Mitochondrial Rho GTPase 1; MIRO1; MIRO-1; hMiro-1; Rac-GTP-binding Protein-like Protein) (HRP); EC=3.6.5.-; anti-RHOT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4H4
• Specificity: Recognizes human RHOT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RHOT1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa483-581 from human RHOT1 (NP_060777) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(RHOT1 monoclonal antibody, Western Blot analysis of RHOT1 expression in HeLa NE.)

Testing Data

(Detection limit for recombinant GST tagged RHOT1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-RHOT1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 75750470
• NCBI GeneID: 55288
• NCBI Accession #: NP_060777
• NCBI GenBank Nucleotide #: NM_018307
• UniProt Accession #: Q8IXI2
• Molecular Weight: 71kDa
• NCBI Official Full Name: mitochondrial Rho GTPase 1 isoform 3
• NCBI Official Synonym Full Names: ras homolog family member T1
• NCBI Official Symbol: RHOT1
• NCBI Official Synonym Symbols: ARHT1; MIRO1; MIRO-1
• NCBI Protein Information: mitochondrial Rho GTPase 1
• UniProt Protein Name: Mitochondrial Rho GTPase 1
• UniProt Gene Name: RHOT1
• UniProt Synonym Gene Names: ARHT1; MIRO-1; hMiro-1
• UniProt Entry Name: MIRO1_HUMAN

Uniprot Description

RHOT1: Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution. Belongs to the mitochondrial Rho GTPase family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric; Membrane protein, integral; Hydrolase; Mitochondrial; G protein, monomeric, Rho; EC 3.6.5.-; G protein

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: membrane; plasma membrane; cytosol; integral to mitochondrial outer membrane

Molecular Function: GTPase activity; protein binding; GTP binding; calcium ion binding

Biological Process: regulation of small GTPase mediated signal transduction; metabolic process; small GTPase mediated signal transduction; cellular homeostasis; mitochondrion transport along microtubule