Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human RBM10 Monoclonal Antibody | anti-RBM10 antibody

RBM10 (DXS8237E, GPATC9, GPATCH9, KIAA0122, RNA-binding Protein 10, G Patch Domain-containing Protein 9, RNA-binding Motif Protein 10, RNA-binding Protein S1-1, MGC1132, MGC997) (HRP)

Gene Names
RBM10; S1-1; TARPS; GPATC9; MGC997; ZRANB5; GPATCH9; MGC1132; DXS8237E; FLJ40796; KIAA0122
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBM10; Monoclonal Antibody; RBM10 (DXS8237E; GPATC9; GPATCH9; KIAA0122; RNA-binding Protein 10; G Patch Domain-containing Protein 9; RNA-binding Motif Protein 10; RNA-binding Protein S1-1; MGC1132; MGC997) (HRP); anti-RBM10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F12
Specificity
Recognizes human RBM10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RBM10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa123-231 from RBM10 (NP_690595) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNL*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Testing Data

(Detection limit for recombinant GST tagged RBM10 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RBM10 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-RBM10 antibody
The protein encoded by this gene contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1. Two transcript variants encoding different isoforms have been identified for this gene.
Product Categories/Family for anti-RBM10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103,533 Da
NCBI Official Full Name
RNA-binding protein 10 isoform 2
NCBI Official Synonym Full Names
RNA binding motif protein 10
NCBI Official Symbol
RBM10
NCBI Official Synonym Symbols
S1-1; TARPS; GPATC9; MGC997; ZRANB5; GPATCH9; MGC1132; DXS8237E; FLJ40796; KIAA0122
NCBI Protein Information
RNA-binding protein 10; OTTHUMP00000023191; OTTHUMP00000023192; RNA-binding protein S1-1; g patch domain-containing protein 9
UniProt Protein Name
RNA-binding protein 10
Protein Family
UniProt Gene Name
RBM10
UniProt Synonym Gene Names
DXS8237E; GPATC9; GPATCH9; KIAA0122; S1-1
UniProt Entry Name
RBM10_HUMAN

Uniprot Description

May be involved in post-transcriptional processing, most probably in mRNA splicing. Binds to RNA homopolymers, with a preference for poly(G) and poly(U) and little for poly(A) ().

Similar Products

Product Notes

The RBM10 rbm10 (Catalog #AAA6154561) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBM10 (DXS8237E, GPATC9, GPATCH9, KIAA0122, RNA-binding Protein 10, G Patch Domain-containing Protein 9, RNA-binding Motif Protein 10, RNA-binding Protein S1-1, MGC1132, MGC997) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBM10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBM10 rbm10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBM10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.