Mouse anti-Human QPRT Monoclonal Antibody | anti-QPRT antibody

QPRT (Nicotinate-nucleotide Pyrophosphorylase [Carboxylating], Quinolinate Phosphoribosyltransferase [Decarboxylating]) (HRP)

Cat. Num. AAA6154457

• Gene Names: QPRT; QPRTase; HEL-S-90n
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: QPRT; Monoclonal Antibody; QPRT (Nicotinate-nucleotide Pyrophosphorylase [Carboxylating]; Quinolinate Phosphoribosyltransferase [Decarboxylating]) (HRP); anti-QPRT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5D11
• Specificity: Recognizes human QPRT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-QPRT antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa198-298 from QPRT (NP_055113) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(QPRT monoclonal antibody Western Blot analysis of QPRT expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to QPRT on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged QPRT is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-QPRT antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 45269149
• NCBI GeneID: 23475
• NCBI Accession #: NP_055113
• NCBI GenBank Nucleotide #: NM_014298
• UniProt Accession #: Q15274; Q53XW7; Q96G22; Q9BSG6
• Molecular Weight: 30,846 Da
• NCBI Official Full Name: nicotinate-nucleotide pyrophosphorylase
• NCBI Official Synonym Full Names: quinolinate phosphoribosyltransferase
• NCBI Official Symbol: QPRT
• NCBI Official Synonym Symbols: QPRTase; HEL-S-90n
• NCBI Protein Information: nicotinate-nucleotide pyrophosphorylase [carboxylating]
• UniProt Protein Name: Nicotinate-nucleotide pyrophosphorylase [carboxylating]
• Protein Family: Nicotinate-nucleotide pyrophosphorylase
• UniProt Gene Name: QPRT
• UniProt Synonym Gene Names: QAPRTase; QPRTase
• UniProt Entry Name: NADC_HUMAN

NCBI Description

This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

QPRT: Involved in the catabolism of quinolinic acid (QA). Belongs to the NadC/ModD family.

Protein type: Transferase; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; EC 2.4.2.19

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cytoplasm; cytosol

Molecular Function: protein homodimerization activity; nicotinate-nucleotide diphosphorylase (carboxylating) activity

Biological Process: NAD biosynthetic process; vitamin metabolic process; NAD metabolic process; water-soluble vitamin metabolic process; protein oligomerization