Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NOS1AP is 0.3ng/ml as a capture antibody.)

Mouse anti-Human NOS1AP Monoclonal Antibody | anti-NOS1AP antibody

NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (HRP)

Gene Names
NOS1AP; CAPON; 6330408P19Rik
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NOS1AP; Monoclonal Antibody; NOS1AP (CAPON; KIAA0464; Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein; C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein; Nitric Oxide Synthase 1 Adaptor Protein) (HRP); anti-NOS1AP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B11
Specificity
Recognizes human NOS1AP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
5016
Applicable Applications for anti-NOS1AP antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa99-202 from NOS1AP (NP_055512) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NOS1AP is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NOS1AP is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-NOS1AP antibody
This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-NOS1AP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens nitric oxide synthase 1 adaptor protein (NOS1AP), transcript variant 1, mRNA
NCBI Official Synonym Full Names
nitric oxide synthase 1 adaptor protein
NCBI Official Symbol
NOS1AP
NCBI Official Synonym Symbols
CAPON; 6330408P19Rik
NCBI Protein Information
carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
UniProt Protein Name
Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
UniProt Gene Name
NOS1AP
UniProt Synonym Gene Names
CAPON; KIAA0464
UniProt Entry Name
CAPON_HUMAN

NCBI Description

This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2009]

Uniprot Description

NOS1AP: Adapter protein involved in neuronal nitric-oxide (NO) synthesis regulation via its association with nNOS/NOS1. The complex formed with NOS1 and synapsins is necessary for specific NO and synapsin functions at a presynaptic level. Mediates an indirect interaction between NOS1 and RASD1 leading to enhance the ability of NOS1 to activate RASD1. Competes with DLG4 for interaction with NOS1, possibly affecting NOS1 activity by regulating the interaction between NOS1 and DLG4. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: nuclear membrane; sarcoplasmic reticulum membrane; mitochondrion; perinuclear region of cytoplasm; T-tubule; caveola; Z disc; cytosol; nucleus; sarcolemma

Molecular Function: nitric-oxide synthase binding

Biological Process: regulation of apoptosis; regulation of nitric oxide biosynthetic process; positive regulation of nitric oxide biosynthetic process; chemical signal regulation of heart rate; positive regulation of nitric-oxide synthase activity; regulation of nitric-oxide synthase activity

Disease: Qt Interval, Variation In

Research Articles on NOS1AP

Similar Products

Product Notes

The NOS1AP nos1ap (Catalog #AAA6153829) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOS1AP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOS1AP nos1ap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOS1AP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.