Mouse anti-Human MFRP Monoclonal Antibody | anti-MFRP antibody

MFRP (Membrane Frizzled-Related Protein, Membrane-type Frizzled-related Protein, C1QTNF5, DKFZp586B0621, FLJ30570, MCOP5, MGC32938 NNO2) (HRP)

Cat. Num. AAA6153510

• Gene Names: MFRP; RD6; NNO2; CTRP5; MCOP5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MFRP; Monoclonal Antibody; MFRP (Membrane Frizzled-Related Protein; Membrane-type Frizzled-related Protein; C1QTNF5; DKFZp586B0621; FLJ30570; MCOP5; MGC32938 NNO2) (HRP); anti-MFRP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b, lambda
• Clone Number: 1E12
• Specificity: Recognizes human MFRP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MFRP antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa480-580 from human MFRP (NP_113621) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MFRP on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MFRP is ~0.3ng/ml as a capture antibody)

Product Categories/Family for anti-MFRP antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13899255
• NCBI GeneID: 83552
• NCBI Accession #: NP_113621
• NCBI GenBank Nucleotide #: NM_031433
• UniProt Accession #: Q9BY79
• Molecular Weight: 62kDa
• NCBI Official Full Name: membrane frizzled-related protein
• NCBI Official Synonym Full Names: membrane frizzled-related protein
• NCBI Official Symbol: MFRP
• NCBI Official Synonym Symbols: RD6; NNO2; CTRP5; MCOP5
• NCBI Protein Information: membrane frizzled-related protein
• UniProt Protein Name: Membrane frizzled-related protein
• Protein Family: Membrane frizzled-related protein
• UniProt Gene Name: MFRP

NCBI Description

This gene encodes a member of the frizzled-related protein family. The encoded protein plays an important role in eye development and mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic transcript which also encodes C1q and tumor necrosis factor related protein 5 (C1QTNF5). [provided by RefSeq, Jun 2013]

Uniprot Description

MFRP: May play a role in eye development. Defects in MFRP are the cause of nanophthalmos 2 (NNO2). NNO2 is a rare autosomal recessive disorder of eye development characterized by extreme hyperopia and small functional eyes. Defects in MFRP are the cause of microphthalmia isolated type 5 (MCOP5). Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataract and other abnormalities like cataract may also be present. MCOP5 is characterized by posterior microphthalmia, retinitis pigmentosa, foveoschisis and optic disc drusen.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: integral to membrane

Disease: Microphthalmia, Isolated 5; Nanophthalmos 2