Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (55.81kD).)

Mouse anti-Human MED4 Monoclonal Antibody | anti-MED4 antibody

MED4 (ARC36, DRIP36, VDRIP, Mediator of RNA Polymerase II Transcription Subunit 4, Activator-recruited Cofactor 36kD Component, Mediator Complex Subunit 4, TRAP/SMCC/PC2 Subunit p36 Subunit, Vitamin D3 Receptor-interacting Protein Complex 36kD Component)

Gene Names
MED4; ARC36; VDRIP; DRIP36; TRAP36; HSPC126
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MED4; Monoclonal Antibody; MED4 (ARC36; DRIP36; VDRIP; Mediator of RNA Polymerase II Transcription Subunit 4; Activator-recruited Cofactor 36kD Component; Mediator Complex Subunit 4; TRAP/SMCC/PC2 Subunit p36 Subunit; Vitamin D3 Receptor-interacting Protein Complex 36kD Component); anti-MED4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B10
Specificity
Recognizes human MED4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MED4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-271 from human MED4 (AAH05189) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (55.81kD).)

Western Blot (WB) (Western Blot detection against Immunogen (55.81kD).)

Western Blot (WB)

(Western Blot analysis of MED4 expression in transfected 293T cell line by MED4 monoclonal antibody. Lane 1: MED4 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MED4 expression in transfected 293T cell line by MED4 monoclonal antibody. Lane 1: MED4 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MED4 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MED4 is 1ng/ml as a capture antibody.)
Related Product Information for anti-MED4 antibody
The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II (see MIM 180660)-transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (summary by Sato et al., 2004 [PubMed 15175163]).
Product Categories/Family for anti-MED4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,947 Da
NCBI Official Full Name
Homo sapiens mediator complex subunit 4, mRNA
NCBI Official Synonym Full Names
mediator complex subunit 4
NCBI Official Symbol
MED4
NCBI Official Synonym Symbols
ARC36; VDRIP; DRIP36; TRAP36; HSPC126
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 4

NCBI Description

This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Research Articles on MED4

Similar Products

Product Notes

The MED4 (Catalog #AAA6153485) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MED4 (ARC36, DRIP36, VDRIP, Mediator of RNA Polymerase II Transcription Subunit 4, Activator-recruited Cofactor 36kD Component, Mediator Complex Subunit 4, TRAP/SMCC/PC2 Subunit p36 Subunit, Vitamin D3 Receptor-interacting Protein Complex 36kD Component) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MED4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MED4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MED4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.