Mouse anti-Human LSM3 Monoclonal Antibody | anti-LSM3 antibody

LSM3 (U6 snRNA-associated Sm-like Protein LSm3, MDS017) (HRP)

Cat. Num. AAA6153368

• Gene Names: LSM3; SMX4; USS2; YLR438C
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LSM3; Monoclonal Antibody; LSM3 (U6 snRNA-associated Sm-like Protein LSm3; MDS017) (HRP); anti-LSM3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4C8-2D10
• Specificity: Recognizes human LSM3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-LSM3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-103 from human LSM3 (AAH07055) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.33kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LSM3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged LSM3 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-LSM3 antibody

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Product Categories/Family for anti-LSM3 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13937894
• NCBI GeneID: 27258
• Molecular Weight: 11,845 Da
• NCBI Official Full Name: Homo sapiens LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae), mRNA
• NCBI Official Synonym Full Names: LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
• NCBI Official Symbol: LSM3
• NCBI Official Synonym Symbols: SMX4; USS2; YLR438C
• NCBI Protein Information: U6 snRNA-associated Sm-like protein LSm3
• Protein Family: U6 snRNA-associated Sm-like protein

NCBI Description

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004]