Mouse anti-Human IL2RA Monoclonal Antibody | anti-IL2RA antibody

IL2RA (Interleukin-2 Receptor Subunit alpha, IL-2 Receptor Subunit alpha, IL-2-RA, IL-2R Subunit alpha, IL2-RA, TAC Antigen, p55, CD25) (HRP)

Cat. Num. AAA6153073

• Gene Names: IL2RA; p55; CD25; IL2R; IMD41; TCGFR; IDDM10
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL2RA; Monoclonal Antibody; IL2RA (Interleukin-2 Receptor Subunit alpha; IL-2 Receptor Subunit alpha; IL-2-RA; IL-2R Subunit alpha; IL2-RA; TAC Antigen; p55; CD25) (HRP); anti-IL2RA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D6
• Specificity: Recognizes human IL2RA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-IL2RA antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa22-122 from human IL2RA (NP_000408) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Related Product Information for anti-IL2RA antibody

IL-2 receptor alpha (IL-2 RA), also known as CD25, is a 55kD type I membrane glycoprotein that belongs to a family of cytokine receptors that utilize the common gamma chain subunit (Gc). IL-2 RA is primarily expressed on activated T cells and on regulatory T cells (Treg). IL-2 RABBIT (CD122) and Gc (IL-2 RG/CD132) dimerize to form a constitutively expressed intermediate affinity IL-2 receptor. By itself, IL-2 RA binds IL-2 with low affinity. It associates with IL-2 RB and GC to generate a ternary high affinity IL-2 receptor complex. A soluble form of IL-2 RA can be generated by proteolytic cleavage of the cell surface receptor, rendering the T cell unresponsive to IL-2. Increased serum levels of soluble IL-2 RA are found in some cancers and immune disorders. IL-2 RA is required for activation-induced cell death (AICD) of naive T cells, a mechanism responsible for deleting autoreactive T cell clones. IL-2 RA is also required for the development of CD4+CD25+ Treg which suppress autoreactive CD4+ T cells, thereby contributing to peripheral T cell homeostasis. Within the ECD, canine IL-2 RA shares 49%-60% aa sequence identity with human, mouse, and rat IL-2 RA.

Product Categories/Family for anti-IL2RA antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4557667
• NCBI GeneID: 3559
• NCBI Accession #: NP_000408
• NCBI GenBank Nucleotide #: NM_000417
• UniProt Accession #: P01589; Q5W007
• Molecular Weight: 52.1kDa (461aa) 50-70kDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: interleukin-2 receptor subunit alpha isoform 1
• NCBI Official Synonym Full Names: interleukin 2 receptor subunit alpha
• NCBI Official Symbol: IL2RA
• NCBI Official Synonym Symbols: p55; CD25; IL2R; IMD41; TCGFR; IDDM10
• NCBI Protein Information: interleukin-2 receptor subunit alpha
• UniProt Protein Name: Interleukin-2 receptor subunit alpha
• Protein Family: Interleukin-2 receptor
• UniProt Gene Name: IL2RA
• UniProt Synonym Gene Names: IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA
• UniProt Entry Name: IL2RA_HUMAN

NCBI Description

The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.[provided by RefSeq, Nov 2009]

Uniprot Description

IL2RA: Receptor for interleukin-2. Non-covalent dimer of an alpha and a beta subunit. IL2R exists in 3 different forms: a high affinity dimer, an intermediate affinity monomer (beta subunit), and a low affinity monomer (alpha subunit). The high and intermediate affinity forms also associate with a gamma subunit.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 10p15-p14

Cellular Component: integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: interleukin-2 receptor activity; drug binding; interleukin-2 binding

Biological Process: Notch signaling pathway; regulation of T cell homeostatic proliferation; apoptosis; negative regulation of immune response; negative regulation of defense response to virus; positive regulation of activated T cell proliferation; cell proliferation; negative regulation of T cell proliferation; inflammatory response to antigenic stimulus; cell surface receptor linked signal transduction; positive regulation of T cell differentiation; negative regulation of inflammatory response; immune response; inflammatory response; activated T cell apoptosis

Disease: Interleukin 2 Receptor, Alpha, Deficiency Of; Diabetes Mellitus, Insulin-dependent, 10