Mouse anti-Human, Mouse EDIL3 Monoclonal Antibody | anti-EDIL3 antibody

EDIL3 (Integrin-binding Protein DEL1, Developmentally-regulated Endothelial Cell Locus 1 Protein, EGF-like Repeat and Discoidin I-like Domain-containing Protein 3, DEL1) (HRP)

Cat. Num. AAA6152270

• Gene Names: EDIL3; DEL1
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EDIL3; Monoclonal Antibody; EDIL3 (Integrin-binding Protein DEL1; Developmentally-regulated Endothelial Cell Locus 1 Protein; EGF-like Repeat and Discoidin I-like Domain-containing Protein 3; DEL1) (HRP); anti-EDIL3 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C9
• Specificity: Recognizes human EDIL3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 4814

• Applicable Applications for anti-EDIL3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa101-199 from EDIL3 (NP_005702) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(EDIL3 monoclonal antibody. Western Blot analysis of EDIL3 expression in human pancreas.)

Testing Data

(Detection limit for recombinant GST tagged EDIL3 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-EDIL3 antibody

EDIL3 is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior.

Product Categories/Family for anti-EDIL3 antibody

Antibodies; Integrin

NCBI and Uniprot Product Information

• NCBI GI #: 1519246277
• NCBI GeneID: 10085
• NCBI Accession #: NM_005711.5
• NCBI GenBank Nucleotide #: NM_005711
• NCBI Official Full Name: Homo sapiens EGF like repeats and discoidin domains 3 (EDIL3), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: EGF like repeats and discoidin domains 3
• NCBI Official Symbol: EDIL3
• NCBI Official Synonym Symbols: DEL1
• NCBI Protein Information: EGF-like repeat and discoidin I-like domain-containing protein 3
• Protein Family: EGF-like repeat and discoidin I-like domain-containing protein

NCBI Description

The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq, Jul 2008]