Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (85.84kD).)

Mouse anti-Human CHEK2 Monoclonal Antibody | anti-CHEK2 antibody

CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (HRP)

Gene Names
CHEK2; CDS1; CHK2; LFS2; RAD53; hCds1; HuCds1; PP1425
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHEK2; Monoclonal Antibody; CHEK2 (Serine/Threonine-protein Kinase Chk2; CHK2 Checkpoint Homolog; Cds1 Homolog; Hucds1; hCds1; Checkpoint Kinase 2; CDS1; CHK2; RAD53) (HRP); anti-CHEK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B7
Specificity
Recognizes human CHEK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CHEK2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-544 from CHEK2 (AAH04207) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (85.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (85.84kD).)

Western Blot (WB)

(CHEK2 monoclonal antibody Western Blot analysis of CHEK2 expression in HeLa.)

Western Blot (WB) (CHEK2 monoclonal antibody Western Blot analysis of CHEK2 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CHEK2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CHEK2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CHEK2 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CHEK2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CHEK2 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CHEK2 is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(CHEK2 monoclonal antibody Western Blot analysis of CHEK2 expression in HeLa NE.)

Western Blot (WB) (CHEK2 monoclonal antibody Western Blot analysis of CHEK2 expression in HeLa NE.)
Product Categories/Family for anti-CHEK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
36,157 Da
NCBI Official Full Name
Homo sapiens CHK2 checkpoint homolog (S. pombe), mRNA
NCBI Official Synonym Full Names
checkpoint kinase 2
NCBI Official Symbol
CHEK2
NCBI Official Synonym Symbols
CDS1; CHK2; LFS2; RAD53; hCds1; HuCds1; PP1425
NCBI Protein Information
serine/threonine-protein kinase Chk2

NCBI Description

In response to DNA damage and replication blocks, cell cycle progression is halted through the control of critical cell cycle regulators. The protein encoded by this gene is a cell cycle checkpoint regulator and putative tumor suppressor. It contains a forkhead-associated protein interaction domain essential for activation in response to DNA damage and is rapidly phosphorylated in response to replication blocks and DNA damage. When activated, the encoded protein is known to inhibit CDC25C phosphatase, preventing entry into mitosis, and has been shown to stabilize the tumor suppressor protein p53, leading to cell cycle arrest in G1. In addition, this protein interacts with and phosphorylates BRCA1, allowing BRCA1 to restore survival after DNA damage. Mutations in this gene have been linked with Li-Fraumeni syndrome, a highly penetrant familial cancer phenotype usually associated with inherited mutations in TP53. Also, mutations in this gene are thought to confer a predisposition to sarcomas, breast cancer, and brain tumors. This nuclear protein is a member of the CDS1 subfamily of serine/threonine protein kinases. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Research Articles on CHEK2

Similar Products

Product Notes

The CHEK2 (Catalog #AAA6151786) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHEK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHEK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHEK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.