Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.65kD).)

Mouse anti-Human Calcitonin Receptor Monoclonal Antibody | anti-CALCR antibody

Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) (HRP)

Gene Names
CALCR; CRT; CTR; CT-R; CTR1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Calcitonin Receptor; Monoclonal Antibody; Calcitonin Receptor (CALCR; CRT; CTR; CT-R; CTR1) (HRP); anti-CALCR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F7
Specificity
Recognizes human CALCR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CALCR antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa394-474 from CALCR (NP_001733.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.65kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.65kD).)

Testing Data

(Detection limit for recombinant GST tagged CALCR is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CALCR is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-CALCR antibody
The Calcitonin Receptor (CALCR) inhibits bone resorption. This receptor is expressed during development and is involved in morphogenesis. Three alternatively spliced Calcitonin Receptor isoforms have been identified. In addition to binding calcitonin, the Calcitonin Receptor can complex with RAMP3 (receptor activity modifying protein) to bind amylin, which regulates pancreatic islet function and is involved in Type II diabetes.
Product Categories/Family for anti-CALCR antibody
References
1. Identification of the calcitonin receptor in osteoarthritic chondrocytes. Segovia-Silvestre T, Bonnefond C, Sondergaard BC, Christensen T, Karsdal MA, Bay-Jensen AC.BMC Res Notes. 2011 Oct 13;4(1):407.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
799
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,423 Da
NCBI Official Full Name
calcitonin receptor isoform 2
NCBI Official Synonym Full Names
calcitonin receptor
NCBI Official Symbol
CALCR
NCBI Official Synonym Symbols
CRT; CTR; CT-R; CTR1
NCBI Protein Information
calcitonin receptor
UniProt Protein Name
Calcitonin receptor
Protein Family
UniProt Gene Name
CALCR
UniProt Synonym Gene Names
CT-R
UniProt Entry Name
CALCR_HUMAN

NCBI Description

This gene encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

Uniprot Description

CALCR: This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin. Belongs to the G-protein coupled receptor 2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 2

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; calcitonin binding; receptor activity; protein transporter activity; calcitonin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; protein transport; elevation of cytosolic calcium ion concentration; phospholipase C activation; receptor internalization; adenylate cyclase activation; response to glucocorticoid stimulus; positive regulation of cAMP biosynthetic process; positive regulation of adenylate cyclase activity; G-protein signaling, adenylate cyclase activating pathway

Disease: Osteoporosis

Research Articles on CALCR

Similar Products

Product Notes

The CALCR calcr (Catalog #AAA6151540) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Calcitonin Receptor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CALCR calcr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Calcitonin Receptor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.