Mouse anti-Human AXIN1 Monoclonal Antibody | anti-AXIN1 antibody

AXIN1 (Axin 1, Axin-1, AXIN, Axis Inhibition Protein 1, hAxin, MGC52315) (HRP)

Cat. Num. AAA6151367

• Gene Names: AXIN1; AXIN; PPP1R49
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AXIN1; Monoclonal Antibody; AXIN1 (Axin 1; Axin-1; AXIN; Axis Inhibition Protein 1; hAxin; MGC52315) (HRP); anti-AXIN1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B11
• Specificity: Recognizes human AXIN1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-AXIN1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa643-741 from AXIN1 (NP_003493) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AXIN1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged AXIN1 is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GSK3B and AXIN1 HeLa cells were stained with GSK3B rabbit purified polyclonal 1:1200 and AXIN1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-AXIN1 antibody

Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects; down-regulates CTNNB1 to inhibit the Wnt signaling pathway and ventralize embryos, but also dorsalizes embryos by activating a Wnt-independent JNK signaling pathway. In Wnt signaling, probably facilitates the phosphorylation of CTNNB1 and APC by GSK3B. Likely to function as a tumor suppressor. Facilitates the phosphorylation of TP53 by HIPK2 upon ultraviolet irradiation. Enhances TGF-beta signaling by recruiting the RNF111 E3 ubiquitin ligase and promoting the degradation of inhibitory SMAD7. Also component of the AXIN1-HIPK2-TP53 complex which controls cell growth, apoptosis and development.

Product Categories/Family for anti-AXIN1 antibody

Antibodies; Wnt Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 27501450
• NCBI GeneID: 8312
• NCBI Accession #: NP_003493
• NCBI GenBank Nucleotide #: NM_003502
• UniProt Accession #: O15169; Q4TT26; Q4TT27; Q86YA7; Q8WVW6; Q96S28
• Molecular Weight: 91,653 Da
• NCBI Official Full Name: axin-1 isoform a
• NCBI Official Synonym Full Names: axin 1
• NCBI Official Symbol: AXIN1
• NCBI Official Synonym Symbols: AXIN; PPP1R49
• NCBI Protein Information: axin-1; axis inhibition protein 1; axis inhibitor 1; fused, mouse, homolog of; protein phosphatase 1, regulatory subunit 49
• UniProt Protein Name: Axin-1
• Protein Family: Axin
• UniProt Gene Name: AXIN1
• UniProt Synonym Gene Names: AXIN; hAxin
• UniProt Entry Name: AXIN1_HUMAN

Uniprot Description

axin 1: is a negative regulator of the Wnt pathway, which is critical in stem cell signaling, morphogenesis, the mesenchymal-epithelial transition, and many cancers. Axin-1 functions as a tumor suppressor. Probably facilitates the phosphorylation of beta-catenin and APC by GSK3B, leading to their ubiquitination and subsequent proteolysis. Wild-type axin 1 can induce apoptosis in hepatocellular and colorectal cancer cells. Is downregulated during progression of esophageal squamous cell carcinoma. Mutation of the axin-1 gene is associated with hepatocellular carcinoma, anaplastic thyroid cancer, medulloblastoma and colorectal cancer. May have a role in oncogenesis in Hodgkin lymphoma. Axin1/2 mediate cross-talk between TGF-beta and Wnt signaling pathways.

Protein type: Tumor suppressor; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; cytoplasmic microtubule; cytoplasmic membrane-bound vesicle; postsynaptic density; cytoplasm; cell cortex; cytoplasmic vesicle; cytosol; beta-catenin destruction complex; nucleus; lateral plasma membrane

Molecular Function: protein C-terminus binding; identical protein binding; protein homodimerization activity; protein self-association; p53 binding; beta-catenin binding; protein kinase binding; GTPase activator activity; signal transducer activity; protein binding; receptor signaling complex scaffold activity; enzyme binding; ubiquitin protein ligase binding; protein complex scaffold; SMAD binding; receptor binding

Biological Process: cell death; protein polyubiquitination; negative regulation of Wnt receptor signaling pathway; apoptosis; embryonic eye morphogenesis; positive regulation of transcription, DNA-dependent; positive regulation of JNK cascade; negative regulation of protein metabolic process; dorsal/ventral axis specification; nucleocytoplasmic transport; Wnt receptor signaling pathway through beta-catenin; olfactory placode formation; activation of JNK activity; cytoplasmic microtubule organization and biogenesis; sensory perception of sound; positive regulation of ubiquitin-protein ligase activity; Wnt receptor signaling pathway involved in forebrain neuron fate commitment; protein catabolic process; protein homooligomerization; axial mesoderm formation; in utero embryonic development; positive regulation of transforming growth factor beta receptor signaling pathway; muscle cell development; negative regulation of fat cell differentiation; optic placode formation; positive regulation of peptidyl-serine phosphorylation; cellular protein complex assembly; positive regulation of protein ubiquitination; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; forebrain anterior/posterior pattern formation; activation of protein kinase activity; positive regulation of protein catabolic process; positive regulation of protein amino acid phosphorylation; determination of left/right symmetry; positive regulation of GTPase activity

Disease: Caudal Duplication Anomaly; Hepatocellular Carcinoma