Mouse anti-Human ATP6V1E1 Monoclonal Antibody | anti-ATP6V1E1 antibody

ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (HRP)

Cat. Num. AAA6151350

• Gene Names: ATP6V1E1; P31; Vma4; ATP6E; ATP6E2; ATP6V1E
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATP6V1E1; Monoclonal Antibody; ATP6V1E1 (V-type Proton ATPase Subunit E 1; V-ATPase Subunit E 1; V-ATPase 31kD Subunit; p31; Vacuolar Proton Pump Subunit E 1; ATP6E; ATP6E2) (HRP); anti-ATP6V1E1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E11
• Specificity: Recognizes human ATP6V1E1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ATP6V1E1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-226 from human ATP6V1E1 (AAH04443) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (50.6kD).)

Western Blot (WB)

(Western Blot analysis of ATP6V1E1 expression in transfected 293T cell line by ATP6V1E1 monoclonal antibody. Lane 1: ATP6V1E1 transfected lysate (26.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ATP6V1E1 is 1ng/ml as a capture antibody.)

Related Product Information for anti-ATP6V1E1 antibody

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Product Categories/Family for anti-ATP6V1E1 antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 13325247
• NCBI GeneID: 529
• UniProt Accession #: P36543; A8MUE4; A8MUN4
• Molecular Weight: 22,706 Da
• NCBI Official Full Name: Homo sapiens ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1, mRNA
• NCBI Official Synonym Full Names: ATPase H+ transporting V1 subunit E1
• NCBI Official Symbol: ATP6V1E1
• NCBI Official Synonym Symbols: P31; Vma4; ATP6E; ATP6E2; ATP6V1E
• NCBI Protein Information: V-type proton ATPase subunit E 1
• UniProt Protein Name: V-type proton ATPase subunit e 1
• UniProt Gene Name: ATP6V0E1
• UniProt Synonym Gene Names: ATP6H; ATP6V0E; V-ATPase subunit e 1
• UniProt Entry Name: VA0E1_HUMAN

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP6V0E1: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the V-ATPase e1/e2 subunit family.

Protein type: Transporter, ion channel; Membrane protein, integral; Transporter, iron; Transporter; Hydrolase; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: phagocytic vesicle membrane; membrane; integral to membrane; endosome membrane

Molecular Function: ATPase activity, coupled to transmembrane movement of ions; transporter activity; hydrogen ion transporting ATPase activity, rotational mechanism

Biological Process: interaction with host; vacuolar acidification; proton transport; cellular iron ion homeostasis; metabolic process; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; transferrin transport; response to amino acid stimulus; cell growth; transmembrane transport