Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human, Mouse ARPC3 Monoclonal Antibody | anti-ARPC3 antibody

ARPC3 (Actin-related Protein 2/3 Complex Subunit 3, Arp2/3 Complex 21kD Subunit, p21-ARC, ARC21) (HRP)

Gene Names
ARPC3; ARC21; p21-Arc
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARPC3; Monoclonal Antibody; ARPC3 (Actin-related Protein 2/3 Complex Subunit 3; Arp2/3 Complex 21kD Subunit; p21-ARC; ARC21) (HRP); anti-ARPC3 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E11
Specificity
Recognizes human ARPC3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ARPC3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-78 from ARPC3 (NP_005710) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISEC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.69kD).)

Western Blot (WB)

(Western Blot analysis of ARPC3 expression in transfected 293T cell line by ARPC3 monoclonal antibody Lane 1: ARPC3 transfected lysate (20.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ARPC3 antibody
ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.
Product Categories/Family for anti-ARPC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Synonym Full Names
actin related protein 2/3 complex subunit 3
NCBI Official Symbol
ARPC3
NCBI Official Synonym Symbols
ARC21; p21-Arc
NCBI Protein Information
actin-related protein 2/3 complex subunit 3
UniProt Protein Name
Actin-related protein 2/3 complex subunit 3
UniProt Gene Name
ARPC3
UniProt Synonym Gene Names
ARC21; p21-ARC
UniProt Entry Name
ARPC3_HUMAN

NCBI Description

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013]

Uniprot Description

ARPC3: one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12q24.11

Cellular Component: Arp2/3 protein complex; focal adhesion; membrane; lamellipodium; cytosol; actin cytoskeleton

Molecular Function: actin filament binding; protein binding; structural constituent of cytoskeleton

Biological Process: axon guidance; ephrin receptor signaling pathway; innate immune response; cell motility

Research Articles on ARPC3

Similar Products

Product Notes

The ARPC3 arpc3 (Catalog #AAA6151285) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARPC3 (Actin-related Protein 2/3 Complex Subunit 3, Arp2/3 Complex 21kD Subunit, p21-ARC, ARC21) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ARPC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARPC3 arpc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARPC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual