Mouse anti-Human ADAMDEC1 Monoclonal Antibody | anti-ADAMDEC1 antibody

ADAMDEC1 (ADAM DEC1, A Disintegrin and Metalloproteinase Domain-like Protein Decysin-1, ADAM-like Protein Decysin-1) (HRP)

Cat. Num. AAA6151093

• Gene Names: ADAMDEC1; M12.219
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ADAMDEC1; Monoclonal Antibody; ADAMDEC1 (ADAM DEC1; A Disintegrin and Metalloproteinase Domain-like Protein Decysin-1; ADAM-like Protein Decysin-1) (HRP); anti-ADAMDEC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6C4
• Specificity: Recognizes human ADAMDEC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ADAMDEC1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa361-471 from human ADAMDEC1 (NP_055294) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ADAMDEC1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ADAMDEC1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-ADAMDEC1 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 7657319
• NCBI GeneID: 27299
• NCBI Accession #: NP_055294
• NCBI GenBank Nucleotide #: NM_014479
• UniProt Accession #: O15204
• Molecular Weight: 53kDa
• NCBI Official Full Name: ADAM DEC1 isoform 1
• NCBI Official Synonym Full Names: ADAM like decysin 1
• NCBI Official Symbol: ADAMDEC1
• NCBI Official Synonym Symbols: M12.219
• NCBI Protein Information: ADAM DEC1
• UniProt Protein Name: ADAM DEC1
• Protein Family: ADAM
• UniProt Gene Name: ADAMDEC1
• UniProt Synonym Gene Names: ADAM-like protein decysin-1
• UniProt Entry Name: ADEC1_HUMAN

NCBI Description

This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play an important role in the control of the immune response and during pregnancy

By similarity.

Cofactor: Binds 1 zinc ion per subunit

By similarity.

Subcellular location: Secreted

By similarity.

Tissue specificity: Expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. Predominantly expressed in dendritic cells (DC) of the germinal center. Weakly expressed in monocyte and highly expressed in macrophage. Absent in immature DC. Ref.1 Ref.5

Induction: Induced during DC maturation and up-regulated in response to T-cell signals. In macrophage up-regulated by bacterial lipopolysaccharides (LPS). Up-regulated by 1-alpha,25-dihydroxyvitamin D3 during differentiation of primary monocyte into macrophage. Ref.1 Ref.5

Sequence similarities: Contains 1 disintegrin domain.Contains 1 peptidase M12B domain.