Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human UGT1A3 Monoclonal Antibody | anti-UGT1A3 antibody

UGT1A3 (UDP-glucuronosyltransferase 1A3, UDP-glucuronosyltransferase 1-3, UDPGT 1-3, UGT1*3, UGT1-03, UGT1.3, UGT1, UDP-glucuronosyltransferase 1-C, UGT1C, UGT-1C, GNT1) (FITC)

Gene Names
UGT1A3; UDPGT; UGT1C; UGT-1C; UGT1.3; UGT1-03; UGT1A3S; UDPGT 1-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UGT1A3; Monoclonal Antibody; UGT1A3 (UDP-glucuronosyltransferase 1A3; UDP-glucuronosyltransferase 1-3; UDPGT 1-3; UGT1*3; UGT1-03; UGT1.3; UGT1; UDP-glucuronosyltransferase 1-C; UGT1C; UGT-1C; GNT1) (FITC); EC=2.4.1.17; anti-UGT1A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C10
Specificity
Recognizes human UGT1A3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
534
Applicable Applications for anti-UGT1A3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa30-130 from human UGT1A3 (NP_061966) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged UGT1A3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UGT1A3 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-UGT1A3 antibody
References
1. Coffee induces expression of glucuronosyltransferases via the aryl hydrocarbon receptor and Nrf2 in liver and stomach. Kalthoff S, Ehmer U, Freiberg N, Manns MP, Strassburg CP.Gastroenterology. 2010 Jun 20.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
UDP-glucuronosyltransferase 1-3
NCBI Official Synonym Full Names
UDP glucuronosyltransferase family 1 member A3
NCBI Official Symbol
UGT1A3
NCBI Official Synonym Symbols
UDPGT; UGT1C; UGT-1C; UGT1.3; UGT1-03; UGT1A3S; UDPGT 1-3
NCBI Protein Information
UDP-glucuronosyltransferase 1-3
UniProt Protein Name
UDP-glucuronosyltransferase 1-3
UniProt Gene Name
UGT1A3
UniProt Synonym Gene Names
GNT1; UGT1; UDPGT 1-3; UGT1*3; UGT1-03; UGT1.3; UGT-1C; UGT1C
UniProt Entry Name
UD13_HUMAN

NCBI Description

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. Substrates of this enzyme include estrone, 2-hydroxyestrone, and metabolites of benzo alpha-pyrene. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Catalytic activity: UDP-glucuronate + acceptor = UDP + acceptor beta-D-glucuronoside.

Subcellular location: Microsome. Endoplasmic reticulum membrane; Single-pass membrane protein

Potential.

Sequence similarities: Belongs to the UDP-glycosyltransferase family.

Research Articles on UGT1A3

Similar Products

Product Notes

The UGT1A3 ugt1a3 (Catalog #AAA6150362) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UGT1A3 (UDP-glucuronosyltransferase 1A3, UDP-glucuronosyltransferase 1-3, UDPGT 1-3, UGT1*3, UGT1-03, UGT1.3, UGT1, UDP-glucuronosyltransferase 1-C, UGT1C, UGT-1C, GNT1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UGT1A3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UGT1A3 ugt1a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UGT1A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.