Mouse anti-Human TAX1BP1 Monoclonal Antibody | anti-TAX1BP1 antibody

TAX1BP1 (Tax1-binding Protein 1, TRAF6-binding Protein, T6BP, PRO0105) (FITC)

Cat. Num. AAA6150034

• Gene Names: TAX1BP1; T6BP; TXBP151; CALCOCO3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAX1BP1; Monoclonal Antibody; TAX1BP1 (Tax1-binding Protein 1; TRAF6-binding Protein; T6BP; PRO0105) (FITC); anti-TAX1BP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C3
• Specificity: Recognizes human TAX1BP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 789

• Applicable Applications for anti-TAX1BP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa690-790 from TAX1BP1 (NP_006015) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TAX1BP1 monoclonal antibody, Western Blot analysis of TAX1BP1 expression in A-431,)

Western Blot (WB)

(Western Blot analysis of TAX1BP1 expression in transfected 293T cell line by TAX1BP1 monoclonal antibody. Lane 1: TAX1BP1 transfected lysate (90.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TAX1BP1 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-TAX1BP1 antibody

Inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade.

Product Categories/Family for anti-TAX1BP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21361682
• NCBI GeneID: 8887
• NCBI Accession #: NP_006015
• NCBI GenBank Nucleotide #: NM_006024
• UniProt Accession #: Q86VP1
• NCBI Official Full Name: tax1-binding protein 1 isoform 1
• NCBI Official Synonym Full Names: Tax1 binding protein 1
• NCBI Official Symbol: TAX1BP1
• NCBI Official Synonym Symbols: T6BP; TXBP151; CALCOCO3
• NCBI Protein Information: tax1-binding protein 1
• UniProt Protein Name: Tax1-binding protein 1
• Protein Family: Tax1-binding protein
• UniProt Gene Name: TAX1BP1
• UniProt Synonym Gene Names: T6BP
• UniProt Entry Name: TAXB1_HUMAN

NCBI Description

This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated with apoptosis induced by TNF. This protein may also have a role in the inhibition of inflammatory signaling pathways. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011]

Uniprot Description

TAX1BP1: Inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade. Homooligomer. Interacts with TRAF6 in a IL-1-dependent manner. Interacts with TNFAIP3. Interacts with STARD13. Interacts with the HTLV-1 protein Tax-1. Expressed in all tissues tested. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: cytosol

Molecular Function: protein binding; metal ion binding; kinase binding

Biological Process: inhibition of NF-kappaB transcription factor; apoptosis; innate immune response; negative regulation of interferon type I production; negative regulation of apoptosis