Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SHC3 Monoclonal Antibody | anti-SHC3 antibody

SHC3 (SHC-transforming Protein 3, Src Homology 2 Domain-containing-transforming Protein C3, SH2 Domain Protein C3, SHC-transforming Protein C, Neuronal Shc, N-Shc, Protein Rai, SHCC, NSHC) (FITC)

Gene Names
SHC3; RAI; NSHC; SHCC; N-Shc
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SHC3; Monoclonal Antibody; SHC3 (SHC-transforming Protein 3; Src Homology 2 Domain-containing-transforming Protein C3; SH2 Domain Protein C3; SHC-transforming Protein C; Neuronal Shc; N-Shc; Protein Rai; SHCC; NSHC) (FITC); anti-SHC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C11
Specificity
Recognizes human SHC3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SHC3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa381-481 from human SHC3 (NP_058544) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGEAPTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of SHC3 expression in transfected 293T cell line by SHC3 monoclonal antibody. Lane 1: SHC3 transfected lysate (64kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SHC3 expression in transfected 293T cell line by SHC3 monoclonal antibody. Lane 1: SHC3 transfected lysate (64kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SHC3 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SHC3 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-SHC3 antibody
SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. Involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.
Product Categories/Family for anti-SHC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
SHC-transforming protein 3
NCBI Official Synonym Full Names
SHC adaptor protein 3
NCBI Official Symbol
SHC3
NCBI Official Synonym Symbols
RAI; NSHC; SHCC; N-Shc
NCBI Protein Information
SHC-transforming protein 3
UniProt Protein Name
SHC-transforming protein 3
Protein Family
UniProt Gene Name
SHC3
UniProt Synonym Gene Names
NSHC; SHCC; N-Shc
UniProt Entry Name
SHC3_HUMAN

Uniprot Description

SHC3: an adapter protein containing an SH2 and a PID domain. Couples activated growth factor receptors to signaling pathway in neurons. Involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons and the regulation of NMDA receptor function in the hippocampus. May modulate hippocampal synaptic plasticity underlying learning and memory. Interacts with the Trk receptors in a phosphotyrosine-dependent manner. Once activated, binds to GRB2. Interacts with activated EGF receptors. Mainly expressed in brain. Hardly detectable in other tissues, except in pancreas. Highly expressed in the cerebral cortex, frontal and temporal lobes, occipital pole, hippocampus, caudate nucleus and amygdala. Expressed at low level in the cerebellum, medulla and spinal cord. A switch from Shc1 to Shc3 occurs during maturation of neuronal precursors to postmitotic neurons. Two alternatively spliced isoforms have been described.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9q22.1

Cellular Component: plasma membrane; cytosol

Molecular Function: signal transducer activity; protein binding; receptor tyrosine kinase binding; protein kinase binding

Biological Process: epidermal growth factor receptor signaling pathway; synaptic transmission, glutamatergic; central nervous system development; learning and/or memory; nerve growth factor receptor signaling pathway; Ras protein signal transduction; insulin receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on SHC3

Similar Products

Product Notes

The SHC3 shc3 (Catalog #AAA6149649) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SHC3 (SHC-transforming Protein 3, Src Homology 2 Domain-containing-transforming Protein C3, SH2 Domain Protein C3, SHC-transforming Protein C, Neuronal Shc, N-Shc, Protein Rai, SHCC, NSHC) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SHC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SHC3 shc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SHC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.