Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human PHF7 Monoclonal Antibody | anti-PHF7 antibody

PHF7 (PHD Finger Protein 7, Testis Development Protein NYD-SP6, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (FITC)

Gene Names
PHF7; HSPC045; HSPC226; NYD-SP6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PHF7; Monoclonal Antibody; PHF7 (PHD Finger Protein 7; Testis Development Protein NYD-SP6; DKFZp434L1850; HSPC045; HSPC226; MGC26088; NYD-SP6) (FITC); anti-PHF7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E9
Specificity
Recognizes human PHF7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PHF7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa258-358 from human PHF7 (NP_057567) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPES
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged PHF7 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PHF7 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-PHF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,259 Da
NCBI Official Full Name
PHD finger protein 7 isoform 1
NCBI Official Synonym Full Names
PHD finger protein 7
NCBI Official Symbol
PHF7
NCBI Official Synonym Symbols
HSPC045; HSPC226; NYD-SP6
NCBI Protein Information
PHD finger protein 7
UniProt Protein Name
PHD finger protein 7
Protein Family
UniProt Gene Name
PHF7
UniProt Entry Name
PHF7_HUMAN

NCBI Description

Spermatogenesis is a complex process regulated by extracellular and intracellular factors as well as cellular interactions among interstitial cells of the testis, Sertoli cells, and germ cells. This gene is expressed in the testis in Sertoli cells but not germ cells. The protein encoded by this gene contains plant homeodomain (PHD) finger domains, also known as leukemia associated protein (LAP) domains, believed to be involved in transcriptional regulation. The protein, which localizes to the nucleus of transfected cells, has been implicated in the transcriptional regulation of spermatogenesis. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

PHF7: May play a role in spermatogenesis.

Protein type: Cell development/differentiation; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: microtubule organizing center; nucleoplasm; nucleus

Molecular Function: protein binding; zinc ion binding

Research Articles on PHF7

Similar Products

Product Notes

The PHF7 phf7 (Catalog #AAA6148823) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PHF7 (PHD Finger Protein 7, Testis Development Protein NYD-SP6, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHF7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHF7 phf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHF7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.