Mouse anti-Human NANOG Monoclonal Antibody | anti-NANOG antibody

NANOG (Homeobox Protein NANOG, Homeobox Transcription Factor Nanog, hNanog, FLJ12581, FLJ40451) (FITC)

Cat. Num. AAA6148390

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NANOG; Monoclonal Antibody; NANOG (Homeobox Protein NANOG; Homeobox Transcription Factor Nanog; hNanog; FLJ12581; FLJ40451) (FITC); anti-NANOG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2C11
• Specificity: Recognizes human NANOG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-NANOG antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa98-196 from human NANOG (NP_079141) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(NANOG monoclonal antibody, Western Blot analysis of NANOG expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged NANOG is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-NANOG antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 153945816
• NCBI GeneID: 79923
• NCBI Accession #: NP_079141
• NCBI GenBank Nucleotide #: NM_024865
• UniProt Accession #: Q9H9S0; Q2TTG0; Q6JZS5; D3DUU4
• Molecular Weight: 32,838 Da
• NCBI Official Full Name: homeobox protein NANOG isoform 1
• NCBI Official Synonym Full Names: Nanog homeobox
• NCBI Official Symbol: NANOG
• NCBI Protein Information: homeobox protein NANOG
• UniProt Protein Name: Homeobox protein NANOG
• Protein Family: NANOG neighbor homeobox
• UniProt Gene Name: NANOG
• UniProt Synonym Gene Names: hNanog
• UniProt Entry Name: NANOG_HUMAN

NCBI Description

The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

NANOG: Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. When overexpressed, promotes cells to enter into S phase and proliferation. Interacts with SMAD1 and SALL4. Expressed in testicular carcinoma and derived germ cell tumors. Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes. Belongs to the Nanog homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; Cell development/differentiation

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: DNA binding; chromatin binding; transcription factor activity; transcription corepressor activity

Biological Process: response to retinoic acid; gonad development; transcription, DNA-dependent; somatic stem cell maintenance; stem cell division; endodermal cell fate specification; stem cell maintenance; negative regulation of transcription from RNA polymerase II promoter; positive regulation of mitotic cell cycle; embryonic pattern specification; mesodermal cell fate commitment; negative regulation of cell fate commitment; negative regulation of BMP signaling pathway; cell proliferation; regulation of transcription, DNA-dependent; regulation of gene expression; regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; cell differentiation