Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MAPK13 monoclonal antibody Western Blot analysis of MAPK13 expression in MCF-7.)

Mouse anti-Human MAPK13 Monoclonal Antibody | anti-MAPK13 antibody

MAPK13 (Mitogen-activated Protein Kinase 13, MAPK 13, MAP Kinase 13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta, Stress-activated Protein Kinase 4, SAPK4, MGC99536) (FITC)

Gene Names
MAPK13; SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAPK13; Monoclonal Antibody; MAPK13 (Mitogen-activated Protein Kinase 13; MAPK 13; MAP Kinase 13; PRKM13; Mitogen-activated Protein Kinase p38 delta; MAP Kinase p38 delta; p38delta; Stress-activated Protein Kinase 4; SAPK4; MGC99536) (FITC); anti-MAPK13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D8
Specificity
Recognizes human MAPK13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MAPK13 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa251-365, from human MAPK13 (AAH00433) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAPK13 monoclonal antibody Western Blot analysis of MAPK13 expression in MCF-7.)

Western Blot (WB) (MAPK13 monoclonal antibody Western Blot analysis of MAPK13 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of MAPK13 expression in transfected 293T cell line by MAPK13 monoclonal antibody. Lane 1: MAPK13 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAPK13 expression in transfected 293T cell line by MAPK13 monoclonal antibody. Lane 1: MAPK13 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAPK13 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MAPK13 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPK13 on MCF-7 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAPK13 on MCF-7 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAPK13 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAPK13 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-MAPK13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
28,779 Da
NCBI Official Full Name
Homo sapiens mitogen-activated protein kinase 13, mRNA
NCBI Official Synonym Full Names
mitogen-activated protein kinase 13
NCBI Official Symbol
MAPK13
NCBI Official Synonym Symbols
SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta
NCBI Protein Information
mitogen-activated protein kinase 13

NCBI Description

This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

Research Articles on MAPK13

Similar Products

Product Notes

The MAPK13 (Catalog #AAA6148119) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPK13 (Mitogen-activated Protein Kinase 13, MAPK 13, MAP Kinase 13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta, Stress-activated Protein Kinase 4, SAPK4, MGC99536) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPK13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPK13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.