Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.1kD))

Mouse anti-Human LHX2 Monoclonal Antibody | anti-LHX2 antibody

LHX2 (LIM/Homeobox Protein Lhx2, LIM Homeobox Protein 2, Homeobox Protein LH-2, LH2) (FITC)

Gene Names
LHX2; LH2; hLhx2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LHX2; Monoclonal Antibody; LHX2 (LIM/Homeobox Protein Lhx2; LIM Homeobox Protein 2; Homeobox Protein LH-2; LH2) (FITC); anti-LHX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E6
Specificity
Recognizes human LHX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
2396
Applicable Applications for anti-LHX2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-76 from LHX2 (NP_004780) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.1kD))

Western Blot (WB) (Western Blot detection against Immunogen (34.1kD))

Western Blot (WB)

(Western Blot analysis of LHX2 expression in transfected 293T cell line by LHX2 monoclonal antibody. Lane 1: LHX2 transfected lysate (44.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LHX2 expression in transfected 293T cell line by LHX2 monoclonal antibody. Lane 1: LHX2 transfected lysate (44.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LHX2 antibody
Acts as a transcriptional activator. Stimulates the promoter of the alpha-glycoprotein gene. Transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.
Product Categories/Family for anti-LHX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens LIM homeobox 2 (LHX2), mRNA
NCBI Official Synonym Full Names
LIM homeobox 2
NCBI Official Symbol
LHX2
NCBI Official Synonym Symbols
LH2; hLhx2
NCBI Protein Information
LIM/homeobox protein Lhx2
UniProt Protein Name
LIM/homeobox protein Lhx2
Protein Family
UniProt Gene Name
LHX2
UniProt Synonym Gene Names
LH2; Homeobox protein LH-2; LIM homeobox protein 2

NCBI Description

This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution. [provided by RefSeq, Jul 2008]

Uniprot Description

LHX2: Acts as a transcriptional activator. Stimulates the promoter of the alpha-glycoprotein gene. Transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 9q33.3

Biological Process: positive regulation of transcription, DNA-dependent

Research Articles on LHX2

Similar Products

Product Notes

The LHX2 lhx2 (Catalog #AAA6148003) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LHX2 (LIM/Homeobox Protein Lhx2, LIM Homeobox Protein 2, Homeobox Protein LH-2, LH2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LHX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LHX2 lhx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LHX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.