Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged KCNK5 is 1ng/ml as a capture antibody.)

Mouse anti-Human KCNK5 Monoclonal Antibody | anti-KCNK5 antibody

KCNK5 (Potassium Channel Subfamily K Member 5, Acid-sensitive Potassium Channel Protein TASK-2, TWIK-related Acid-sensitive K(+) Channel 2, TASK2, FLJ11035, K2p5.1) (FITC)

Gene Names
KCNK5; TASK2; K2p5.1; KCNK5b; TASK-2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KCNK5; Monoclonal Antibody; KCNK5 (Potassium Channel Subfamily K Member 5; Acid-sensitive Potassium Channel Protein TASK-2; TWIK-related Acid-sensitive K(+) Channel 2; TASK2; FLJ11035; K2p5.1) (FITC); anti-KCNK5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B4
Specificity
Recognizes human KCNK5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
3796
Applicable Applications for anti-KCNK5 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-500 from KCNK5 (AAH60793) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPFVFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSLFVNWKVSMFVEVHKA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged KCNK5 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KCNK5 is 1ng/ml as a capture antibody.)
Related Product Information for anti-KCNK5 antibody
pH-dependent, voltage insensitive, outwardly rectifying potassium channel. Outward rectification is lost at high external K(+) concentrations.
Product Categories/Family for anti-KCNK5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens potassium channel, subfamily K, member 5, mRNA
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 5
NCBI Official Symbol
KCNK5
NCBI Official Synonym Symbols
TASK2; K2p5.1; KCNK5b; TASK-2
NCBI Protein Information
potassium channel subfamily K member 5

NCBI Description

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport. [provided by RefSeq, Jul 2008]

Research Articles on KCNK5

Similar Products

Product Notes

The KCNK5 (Catalog #AAA6147879) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNK5 (Potassium Channel Subfamily K Member 5, Acid-sensitive Potassium Channel Protein TASK-2, TWIK-related Acid-sensitive K(+) Channel 2, TASK2, FLJ11035, K2p5.1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNK5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNK5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNK5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.