Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human ILF2 Monoclonal Antibody | anti-ILF2 antibody

ILF2 (Interleukin Enhancer-binding Factor 2, Nuclear Factor of Activated T-cells 45kD, NF45, PRO3063, MGC8391) (FITC)

Gene Names
ILF2; NF45; PRO3063
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ILF2; Monoclonal Antibody; ILF2 (Interleukin Enhancer-binding Factor 2; Nuclear Factor of Activated T-cells 45kD; NF45; PRO3063; MGC8391) (FITC); anti-ILF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E2
Specificity
Recognizes human ILF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ILF2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa151-250 from human ILF2 (NP_004506) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged ILF2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ILF2 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-ILF2 antibody
Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45kD and 90kD proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90kD protein and stimulates its ability to enhance gene expression.
Product Categories/Family for anti-ILF2 antibody
References
1. Dynamic interplay between O-GlcNAcylation and GSK-3-dependent phosphorylation. Wang Z, Pandey A, Hart GW.Mol Cell Proteomics. 2007 Aug;6(8):1365-79. Epub 2007 May 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
interleukin enhancer-binding factor 2 isoform 1
NCBI Official Synonym Full Names
interleukin enhancer binding factor 2
NCBI Official Symbol
ILF2
NCBI Official Synonym Symbols
NF45; PRO3063
NCBI Protein Information
interleukin enhancer-binding factor 2
UniProt Protein Name
Interleukin enhancer-binding factor 2
UniProt Gene Name
ILF2
UniProt Synonym Gene Names
NF45
UniProt Entry Name
ILF2_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. [provided by RefSeq, Dec 2014]

Uniprot Description

ILF2: Appears to function predominantly as a heterodimeric complex with ILF3. This complex may regulate transcription of the IL2 gene during T-cell activation. It can also promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.

Protein type: RNA-binding; Transcription, coactivator/corepressor; Nucleolus

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleolus; ribonucleoprotein complex; nucleus

Molecular Function: transferase activity; protein binding; DNA binding; double-stranded RNA binding; ATP binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; immune response

Research Articles on ILF2

Similar Products

Product Notes

The ILF2 ilf2 (Catalog #AAA6147776) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ILF2 (Interleukin Enhancer-binding Factor 2, Nuclear Factor of Activated T-cells 45kD, NF45, PRO3063, MGC8391) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ILF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ILF2 ilf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ILF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.