Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human HOOK3 Monoclonal Antibody | anti-HOOK3 antibody

HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058) (FITC)

Gene Names
HOOK3; HK3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOOK3; Monoclonal Antibody; HOOK3 (Protein Hook Homolog 3; h-hook3; hHK3; FLJ31058) (FITC); anti-HOOK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A5
Specificity
Recognizes human HOOK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HOOK3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa622-719 from human HOOK3 (NP_115786) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HOOK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HOOK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged HOOK3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOOK3 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-HOOK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,126 Da
NCBI Official Full Name
protein Hook homolog 3
NCBI Official Synonym Full Names
hook microtubule tethering protein 3
NCBI Official Symbol
HOOK3
NCBI Official Synonym Symbols
HK3
NCBI Protein Information
protein Hook homolog 3
UniProt Protein Name
Protein Hook homolog 3
Protein Family
UniProt Gene Name
HOOK3
UniProt Synonym Gene Names
h-hook3; hHK3
UniProt Entry Name
HOOK3_HUMAN

NCBI Description

Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.[supplied by OMIM, Apr 2004]

Uniprot Description

HOOK3: Probably serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking. Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex. Belongs to the hook family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 8p11.21

Cellular Component: centrosome; cis-Golgi network; cytoplasm; cytosol; Golgi apparatus; microtubule; microtubule organizing center; pericentriolar material

Molecular Function: identical protein binding; microtubule binding; protein binding

Biological Process: cytoplasmic microtubule organization and biogenesis; early endosome to late endosome transport; endosome organization and biogenesis; endosome to lysosome transport; Golgi localization; interkinetic nuclear migration; lysosome organization and biogenesis; negative regulation of neurogenesis; protein transport

Research Articles on HOOK3

Similar Products

Product Notes

The HOOK3 hook3 (Catalog #AAA6147623) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOOK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOOK3 hook3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOOK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.