Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human HIRIP3 Monoclonal Antibody | anti-HIRIP3 antibody

HIRIP3 (HIRA-interacting Protein 3) (FITC)

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HIRIP3; Monoclonal Antibody; HIRIP3 (HIRA-interacting Protein 3) (FITC); anti-HIRIP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B3
Specificity
Recognizes human HIRIP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HIRIP3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.7ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa447-555 from HIRIP3 (NP_003600) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSCCSHKERLSILRAELEALGMKGTPSLGKCRALKEQREEAAEVASLDVANIISGSGRPRRRTAWNPLGEAAPPGELYRRTLDSDEERPRPAPPDWSHMRGIISSDGE*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HIRIP3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 0.7ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HIRIP3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 0.7ug/ml].)
Product Categories/Family for anti-HIRIP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
HIRA-interacting protein 3 isoform 1
NCBI Official Synonym Full Names
HIRA interacting protein 3
NCBI Official Symbol
HIRIP3
NCBI Protein Information
HIRA-interacting protein 3
UniProt Protein Name
HIRA-interacting protein 3
Protein Family
UniProt Gene Name
HIRIP3
UniProt Entry Name
HIRP3_HUMAN

NCBI Description

The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of a multiprotein complex. Several cDNAs encoding HIRA-interacting proteins, or HIRIPs, have been identified. In vitro, the protein encoded by this gene binds HIRA, as well as H2B and H3 core histones, indicating that a complex containing HIRA-HIRIP3 could function in some aspects of chromatin and histone metabolism. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Aug 2011]

Uniprot Description

HIRIP3: May play a role in chromatin function and histone metabolism via its interaction with HIRA and histones. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: protein binding

Biological Process: chromatin assembly or disassembly

Research Articles on HIRIP3

Similar Products

Product Notes

The HIRIP3 hirip3 (Catalog #AAA6147586) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HIRIP3 (HIRA-interacting Protein 3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIRIP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.7ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HIRIP3 hirip3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIRIP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.