Mouse anti-Human GPR182 Monoclonal Antibody | anti-GPR182 antibody

GPR182 (G-Protein Coupled Receptor 182, 7TMR, Adrenomedullin Receptor L1, ADMR, AMR, AM-R, G10D, Gamrh, hrhAMR, MGC34399) (FITC)

Cat. Num. AAA6147446

• Gene Names: GPR182; AMR; 7TMR; ADMR; AM-R; G10D; L1-R; gamrh; hrhAMR
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GPR182; Monoclonal Antibody; GPR182 (G-Protein Coupled Receptor 182; 7TMR; Adrenomedullin Receptor L1; ADMR; AMR; AM-R; G10D; Gamrh; hrhAMR; MGC34399) (FITC); anti-GPR182 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B10
• Specificity: Recognizes human GPR182.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 404

• Applicable Applications for anti-GPR182 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-55 from GPR182 (NP_009195) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRV*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.05kD).)

Testing Data

(Detection limit for recombinant GST tagged GPR182 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-GPR182 antibody

Antibodies; G Protein Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 6005705
• NCBI GeneID: 11318
• NCBI Accession #: NP_009195
• NCBI GenBank Nucleotide #: NM_007264
• UniProt Accession #: O15218
• NCBI Official Full Name: G-protein coupled receptor 182
• NCBI Official Synonym Full Names: G protein-coupled receptor 182
• NCBI Official Symbol: GPR182
• NCBI Official Synonym Symbols: AMR; 7TMR; ADMR; AM-R; G10D; L1-R; gamrh; hrhAMR
• NCBI Protein Information: G-protein coupled receptor 182
• UniProt Protein Name: G-protein coupled receptor 182
• Protein Family: G-protein coupled receptor
• UniProt Gene Name: GPR182
• UniProt Synonym Gene Names: ADMR
• UniProt Entry Name: GP182_HUMAN

NCBI Description

Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq, Jul 2008]

Uniprot Description

GPR182: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; transmembrane receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; cell surface receptor linked signal transduction