Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in Raw 264.7.)

Mouse EIF2S2 Monoclonal Antibody | anti-EIF2S2 antibody

EIF2S2 (EIF2B, Eukaryotic Translation Initiation Factor 2 Subunit 2, Eukaryotic Translation Initiation Factor 2 Subunit beta, DKFZp686L18198, EIF2Beta, MGC8508) (FITC)

Gene Names
EIF2S2; EIF2; EIF2B; PPP1R67; EIF2beta; eIF-2-beta
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF2S2; Monoclonal Antibody; EIF2S2 (EIF2B; Eukaryotic Translation Initiation Factor 2 Subunit 2; Eukaryotic Translation Initiation Factor 2 Subunit beta; DKFZp686L18198; EIF2Beta; MGC8508) (FITC); anti-EIF2S2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F3
Specificity
Recognizes human EIF2S2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-EIF2S2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human EIF2S2 (NP_003899) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in Raw 264.7.)

Western Blot (WB) (EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in Raw 264.7.)

Western Blot (WB)

(EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in NIH/3T3.)

Western Blot (WB) (EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of EIF2S2 expression in transfected 293T cell line by EIF2S2 monoclonal antibody. Lane 1: EIF2S2 transfected lysate (38.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EIF2S2 expression in transfected 293T cell line by EIF2S2 monoclonal antibody. Lane 1: EIF2S2 transfected lysate (38.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EIF2S2 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EIF2S2 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged EIF2S2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EIF2S2 is 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in PC-12.)

Western Blot (WB) (EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in PC-12.)

Western Blot (WB)

(EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in HeLa.)

Western Blot (WB) (EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in HeLa.)
Product Categories/Family for anti-EIF2S2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,388 Da
NCBI Official Full Name
eukaryotic translation initiation factor 2 subunit 2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
NCBI Official Symbol
EIF2S2
NCBI Official Synonym Symbols
EIF2; EIF2B; PPP1R67; EIF2beta; eIF-2-beta
NCBI Protein Information
eukaryotic translation initiation factor 2 subunit 2; protein phosphatase 1, regulatory subunit 67; eukaryotic translation initiation factor 2 subunit beta
UniProt Protein Name
Eukaryotic translation initiation factor 2 subunit 2
UniProt Gene Name
EIF2S2
UniProt Synonym Gene Names
EIF2B; eIF-2-beta
UniProt Entry Name
IF2B_HUMAN

NCBI Description

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq, Jul 2008]

Uniprot Description

eIF2-beta: a translational regulatory protein that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: cytoplasm; cytosol; nucleus; eukaryotic translation initiation factor 2 complex

Molecular Function: protein binding; translation factor activity, nucleic acid binding; RNA binding; translation initiation factor activity; metal ion binding

Biological Process: cellular protein metabolic process; translation; in utero embryonic development; male gonad development; translational initiation; gene expression

Research Articles on EIF2S2

Similar Products

Product Notes

The EIF2S2 eif2s2 (Catalog #AAA6146992) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF2S2 (EIF2B, Eukaryotic Translation Initiation Factor 2 Subunit 2, Eukaryotic Translation Initiation Factor 2 Subunit beta, DKFZp686L18198, EIF2Beta, MGC8508) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EIF2S2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF2S2 eif2s2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF2S2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.