Mouse anti-Human CLDN5 Monoclonal Antibody | anti-CLDN5 antibody

CLDN5 (Claudin-5, Transmembrane Protein Deleted in VCFS, TMDVCF, AWAL, TMVCF, BEC1, CPETRL1) (FITC)

Cat. Num. AAA6146540

• Gene Names: CLDN5; AWAL; BEC1; TMVCF; TMDVCF; CPETRL1
• Reactivity: Human
• Applications: FLISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CLDN5; Monoclonal Antibody; CLDN5 (Claudin-5; Transmembrane Protein Deleted in VCFS; TMDVCF; AWAL; TMVCF; BEC1; CPETRL1) (FITC); anti-CLDN5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3D8
• Specificity: Recognizes human CLDN5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CLDN5 antibody: FLISA
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa29-81 from human CLDN5 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CLDN5 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-CLDN5 antibody

Plays a major role in tight junction-specific obliteration of the intercellular space.

Product Categories/Family for anti-CLDN5 antibody

Antibodies; Claudin

NCBI and Uniprot Product Information

• NCBI GI #: 195947372
• NCBI GeneID: 7122
• NCBI Accession #: NP_003268
• NCBI GenBank Nucleotide #: NM_003277
• UniProt Accession #: O00501
• Molecular Weight: 23kDa
• NCBI Official Full Name: claudin-5 isoform 1
• NCBI Official Synonym Full Names: claudin 5
• NCBI Official Symbol: CLDN5
• NCBI Official Synonym Symbols: AWAL; BEC1; TMVCF; TMDVCF; CPETRL1
• NCBI Protein Information: claudin-5
• UniProt Protein Name: Claudin-5
• Protein Family: Claudin
• UniProt Gene Name: CLDN5
• UniProt Synonym Gene Names: AWAL; TMVCF; TMDVCF
• UniProt Entry Name: CLD5_HUMAN

NCBI Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]

Uniprot Description

Claudin-5: Plays a major role in tight junction-specific obliteration of the intercellular space. Belongs to the claudin family.

Protein type: Cytoskeletal; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: tight junction; integral to membrane; plasma membrane; intercellular junction

Molecular Function: identical protein binding; structural molecule activity

Biological Process: calcium-independent cell-cell adhesion