Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human CD5L Monoclonal Antibody | anti-CD5L antibody

CD5L (CD5 Antigen-like, CT-2, IgM-associated Peptide, SP-alpha, API6, UNQ203/PRO229) (FITC)

Gene Names
CD5L; AIM; API6; CT-2; hAIM; PRO229; Spalpha; SP-ALPHA
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD5L; Monoclonal Antibody; CD5L (CD5 Antigen-like; CT-2; IgM-associated Peptide; SP-alpha; API6; UNQ203/PRO229) (FITC); anti-CD5L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C8
Specificity
Recognizes human CD5L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CD5L antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa41-140 from human CD5L (AAH33586) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of CD5L expression in HL-60 usingMBS6000163.)

Western Blot (WB) (Western Blot analysis of CD5L expression in HL-60 usingMBS6000163.)

Western Blot (WB)

(CD5L monoclonal antibody. Western Blot analysis of CD5L expression in different cell lines.)

Western Blot (WB) (CD5L monoclonal antibody. Western Blot analysis of CD5L expression in different cell lines.)

Immunoprecipitation (IP)

(Immunoprecipitation of CD5L transfected lysate using MBS6000163 and Protein A Magnetic Bead and immunoblotted with CD5L rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CD5L transfected lysate using MBS6000163 and Protein A Magnetic Bead and immunoblotted with CD5L rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CD5L is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD5L is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CD5L antibody
CD5L is a member of the scavenger receptor cysteine-rich domain superfamily (SRCR-SF) initially identified as an inducible cell surface ligand of CD5. It was shown that CD5L functions in the thymus as the inducer of resistance to apoptosis within CD4+/CD8+ thymocytes and as the supporter of the viability of these cells before thymic selection. CD5L was also shown to support macrophage survival and enhance their phagocytic function. More recent experiments using recombinant CD5L significantly inhibited apoptosis of NKT and T cells obtained from C. parvum-stimulated livers in vitro, suggesting that CD5L functions to induce resistance to apoptosis in these cells and supports host defense against inflammation during infection.
Product Categories/Family for anti-CD5L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
922
Molecular Weight
38,088 Da
NCBI Official Full Name
Homo sapiens CD5 molecule-like, mRNA
NCBI Official Synonym Full Names
CD5 molecule like
NCBI Official Symbol
CD5L
NCBI Official Synonym Symbols
AIM; API6; CT-2; hAIM; PRO229; Spalpha; SP-ALPHA
NCBI Protein Information
CD5 antigen-like
Protein Family

Research Articles on CD5L

Similar Products

Product Notes

The CD5L (Catalog #AAA6146377) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD5L (CD5 Antigen-like, CT-2, IgM-associated Peptide, SP-alpha, API6, UNQ203/PRO229) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD5L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD5L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD5L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.