Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CD32 Monoclonal Antibody | anti-CD32 antibody

CD32 (FCGR2A, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, IgG Fc Receptor II-a, FCGR2A, FCG2, FCGR2A1, IGFR2) (FITC)

Gene Names
FCGR2A; CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD32; Monoclonal Antibody; CD32 (FCGR2A; CDw32; Fc-gamma RII-a; Fc-gamma-RIIa; FcRII-a; Low Affinity Immunoglobulin gamma Fc Region Receptor II-a; IgG Fc Receptor II-a; FCGR2A; FCG2; FCGR2A1; IGFR2) (FITC); anti-CD32 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E8
Specificity
Recognizes human FCGR2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CD32 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa46-150 from FCGR2A (AAH20823) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-CD32 antibody
Fcg RII, also known as CD32, is a group of three closely related proteins (Fcg RIIA, Fcg RIIB, Fcg RIIC) that share greater than 94% aa identity in their extracellular domains. They function as transmembrane receptors for the Fc portion of IgG molecules. These proteins are expressed by various hematopoietic cells including monocytes, macrophages, neutrophils, NK cells, T cells, and B cells. The Fcg RII proteins are involved in phagocytosis of immune complexes and modulation of antibody production by B cells.
Product Categories/Family for anti-CD32 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
34,930 Da
NCBI Official Full Name
Homo sapiens Fc fragment of IgG, low affinity IIa, receptor (CD32), mRNA
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIa
NCBI Official Symbol
FCGR2A
NCBI Official Synonym Symbols
CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-a
Protein Family

NCBI Description

This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008]

Research Articles on CD32

Similar Products

Product Notes

The CD32 (Catalog #AAA6146357) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD32 (FCGR2A, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, IgG Fc Receptor II-a, FCGR2A, FCG2, FCGR2A1, IGFR2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD32 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD32, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.