Mouse anti-Human ATRX Monoclonal Antibody | anti-ATRX antibody

ATRX (Transcriptional Regulator ATRX, ATP-dependent Helicase ATRX, X-linked Helicase II, X-linked Nuclear Protein, XNP, Znf-HX, ATRX, RAD54L, XH2) (FITC)

Cat. Num. AAA6146057

• Gene Names: ATRX; JMS; SHS; XH2; XNP; ATR2; SFM1; RAD54; MRXHF1; RAD54L; ZNF-HX
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATRX; Monoclonal Antibody; ATRX (Transcriptional Regulator ATRX; ATP-dependent Helicase ATRX; X-linked Helicase II; X-linked Nuclear Protein; XNP; Znf-HX; RAD54L; XH2) (FITC); anti-ATRX antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C9
• Specificity: Recognizes human ATRX.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ATRX antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2311-2410 from human ATRX (NP_000480) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILM
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged ATRX is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-ATRX antibody

The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Product Categories/Family for anti-ATRX antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 530788276
• NCBI GeneID: 546
• NCBI Accession #: NP_000480
• NCBI GenBank Nucleotide #: NM_000489
• UniProt Accession #: P46100; P51068; Q15886; Q59FB5; Q59H31; Q5H9A2; Q5JWI4; Q7Z2J1; Q9H0Z1; Q9NTS3; D3DTE2
• Molecular Weight: 151,556 Da
• NCBI Official Full Name: transcriptional regulator ATRX isoform 1
• NCBI Official Synonym Full Names: alpha thalassemia/mental retardation syndrome X-linked
• NCBI Official Symbol: ATRX
• NCBI Official Synonym Symbols: JMS; SHS; XH2; XNP; ATR2; SFM1; RAD54; MRXHF1; RAD54L; ZNF-HX
• NCBI Protein Information: transcriptional regulator ATRX; ATP-dependent helicase ATRX; DNA dependent ATPase and helicase; X-linked helicase II; X-linked nuclear protein; Zinc finger helicase; alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae); he
• UniProt Protein Name: Transcriptional regulator ATRX
• Protein Family: Transcriptional regulator
• UniProt Gene Name: ATRX
• UniProt Synonym Gene Names: RAD54L; XH2; XNP
• UniProt Entry Name: ATRX_HUMAN

Uniprot Description

ATRX: a global transcriptional regulator. Belongs to the SNF2 family of proteins, many of which modify gene expression via chromatin remodeling activity. Involved in the developmental silencing of imprinted genes in the brain. Contains one PxVxL motif, which is required for interaction with chromoshadow domains. This motif requires additional residues at -7, -6, +4 and +5 relative to the central V which contact the chromoshadow domain. Constitutive mutations in ATRX are associated with brain, facial, and genital abnormalities, and alpha thalassemia. Acquired mutations in ATRX have been observed in preleukemic conditions. Six alternatively spliced human isoforms have been described.

Protein type: DNA repair, damage; Ubiquitin conjugating system; EC 3.6.4.12; Helicase

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: nucleoplasm; PML body; nuclear heterochromatin; nucleus

Molecular Function: protein binding; DNA helicase activity; DNA binding; histone binding; zinc ion binding; chromatin binding; helicase activity; DNA translocase activity; methylated histone residue binding; ATP binding

Biological Process: transcription, DNA-dependent; DNA damage response, signal transduction by p53 class mediator; positive regulation of telomere maintenance; DNA repair; Sertoli cell development; DNA duplex unwinding; replication fork processing; DNA recombination; chromatin remodeling; nucleosome assembly; DNA replication-independent nucleosome assembly; regulation of transcription, DNA-dependent; forebrain development; DNA methylation; spermatogenesis; positive regulation of transcription from RNA polymerase II promoter

Disease: Alpha-thalassemia/mental Retardation Syndrome, X-linked; Mental Retardation-hypotonic Facies Syndrome, X-linked, 1; Alpha-thalassemia Myelodysplasia Syndrome