Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SOX12 Monoclonal Antibody | anti-SOX12 antibody

SOX12 (SRY (Sex Determining Region Y)-box 12, SOX-22 Protein, SRY (Sex Determining Region Y)-box 22, SRY-related HMG-box Gene 22, SOX22) (Biotin)

Gene Names
SOX12; SOX22
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
SOX12; Monoclonal Antibody; SOX12 (SRY (Sex Determining Region Y)-box 12; SOX-22 Protein; SRY (Sex Determining Region Y)-box 22; SRY-related HMG-box Gene 22; SOX22) (Biotin); anti-SOX12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D3
Specificity
Recognizes human SOX12.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SOX12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa252-313 from human SOX12 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-SOX12 antibody
Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types.
Product Categories/Family for anti-SOX12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
transcription factor SOX-12
NCBI Official Synonym Full Names
SRY-box 12
NCBI Official Symbol
SOX12
NCBI Official Synonym Symbols
SOX22
NCBI Protein Information
transcription factor SOX-12
UniProt Protein Name
Transcription factor SOX-12
Protein Family
UniProt Gene Name
SOX12
UniProt Synonym Gene Names
SOX22
UniProt Entry Name
SOX12_HUMAN

NCBI Description

Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains, and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq, Jan 2013]

Uniprot Description

Function: Binds to the sequence 5'-AACAAT-3'

By similarity.

Subcellular location: Nucleus Ref.1.

Tissue specificity: Expressed most abundantly in the CNS. Also expressed in fetal brain and kidney and adult heart, pancreas, testis and ovary. Other tissues were only weakly positive. Ref.1

Sequence similarities: Contains 1 HMG box DNA-binding domain.

Sequence caution: The sequence AAB69627.1 differs from that shown. Reason: Frameshift at positions 135 and 201.

Research Articles on SOX12

Similar Products

Product Notes

The SOX12 sox12 (Catalog #AAA6145563) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOX12 (SRY (Sex Determining Region Y)-box 12, SOX-22 Protein, SRY (Sex Determining Region Y)-box 22, SRY-related HMG-box Gene 22, SOX22) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOX12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOX12 sox12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOX12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.