Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged UVRAG is 0.3ng/ml as a capture antibody.)

Mouse anti-Human UVRAG Monoclonal Antibody | anti-UVRAG antibody

UVRAG (UV Radiation Resistance-associated Gene Protein, p63, DHTX, VPS38) (Biotin)

Gene Names
UVRAG; p63; DHTX; VPS38
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UVRAG; Monoclonal Antibody; UVRAG (UV Radiation Resistance-associated Gene Protein; p63; DHTX; VPS38) (Biotin); UV Radiation Resistance Associated Gene Protein; anti-UVRAG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E8
Specificity
Recognizes human UVRAG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-UVRAG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa601-699 from human UVRAG (NP_003360) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged UVRAG is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UVRAG is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-UVRAG antibody
UVRAG complements the ultraviolet sensitivity of xeroderma pigmentosum group C cells and encodes a protein with a C2 domain. The protein activates the Beclin1-PI(3)KC3 complex, promoting autophagy and suppressing the proliferation and tumorigenicity of human colon cancer cells. Chromosomal aberrations involving this gene are associated with left-right axis malformation and mutations in this gene have been associated with colon cancer.
Product Categories/Family for anti-UVRAG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,988 Da
NCBI Official Full Name
UV radiation resistance-associated gene protein
NCBI Official Synonym Full Names
UV radiation resistance associated
NCBI Official Symbol
UVRAG
NCBI Official Synonym Symbols
p63; DHTX; VPS38
NCBI Protein Information
UV radiation resistance-associated gene protein
UniProt Protein Name
UV radiation resistance-associated gene protein
UniProt Gene Name
UVRAG
UniProt Entry Name
UVRAG_HUMAN

NCBI Description

This gene complements the ultraviolet sensitivity of xeroderma pigmentosum group C cells and encodes a protein with a C2 domain. The protein activates the Beclin1-PI(3)KC3 complex, promoting autophagy and suppressing the proliferation and tumorigenicity of human colon cancer cells. Chromosomal aberrations involving this gene are associated with left-right axis malformation and mutations in this gene have been associated with colon cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

UVRAG: Forms a complex with BECN1, PIK3C3 and PIK3R4. A subpopulation of these complexes also harbor KIAA0226/Rubicon. UVRAG-containing complexes never including ATG14, both forming mutually exclusive complexes with BECN1 through direct competition. Highly expressed in brain, lung, kidney and liver.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: protein complex; lysosome; early endosome; late endosome; cytoplasm; phagocytic vesicle

Molecular Function: protein binding; SNARE binding; SH3 domain binding

Biological Process: entry of virus into host cell; DNA repair; positive regulation of autophagy

Research Articles on UVRAG

Similar Products

Product Notes

The UVRAG uvrag (Catalog #AAA6145114) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UVRAG (UV Radiation Resistance-associated Gene Protein, p63, DHTX, VPS38) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UVRAG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UVRAG uvrag for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UVRAG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.