Testing Data
(Detection limit for recombinant GST tagged NTRK3 is ~3ng/ml as a capture antibody.)
Mouse anti-Human TrkC Monoclonal Antibody | anti-TrkC antibody
TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (Biotin)
Gene Names
NTRK3; TRKC; GP145-TrkC; gp145(trkC)
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TrkC; Monoclonal Antibody; TrkC (GP145-TrkC; NTRK3; NT-3 Growth Factor Receptor; Neurotrophic Tyrosine Kinase Receptor Type 3; TrkC Tyrosine Kinase) (Biotin); anti-TrkC antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D5
Specificity
Recognizes human NTRK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TrkC antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa41-160 from human NTRK3 (AAH13693) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged NTRK3 is ~3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NTRK3 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-TrkC antibody
NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position.
Product Categories/Family for anti-TrkC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
91,833 Da
NCBI Official Full Name
Homo sapiens neurotrophic tyrosine kinase, receptor, type 3, mRNA
NCBI Official Synonym Full Names
neurotrophic receptor tyrosine kinase 3
NCBI Official Symbol
NTRK3
NCBI Official Synonym Symbols
TRKC; GP145-TrkC; gp145(trkC)
NCBI Protein Information
NT-3 growth factor receptor
NCBI Description
This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
Research Articles on TrkC
Similar Products
Product Notes
The TrkC (Catalog #AAA6144941) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TrkC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TrkC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TrkC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
