Mouse anti-Human TNNI2 Monoclonal Antibody | anti-TNNI2 antibody

TNNI2 (Troponin I, Fast Skeletal Muscle, Troponin I, Fast-twitch Isoform) (Biotin)

Cat. Num. AAA6144859

• Gene Names: TNNI2; DA2B; FSSV; fsTnI; AMCD2B
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TNNI2; Monoclonal Antibody; TNNI2 (Troponin I; Fast Skeletal Muscle; Troponin I; Fast-twitch Isoform) (Biotin); anti-TNNI2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D5
• Specificity: Recognizes human TNNI2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-TNNI2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa2-101 of human TNNI2 (NP_003273) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of TNNI2 expression in transfected 293T cell line by TNNI2 monoclonal antibody. Lane 1: TNNI2 transfected lysate (21.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TNNI2 is 3ng/ml as a capture antibody.)

Related Product Information for anti-TNNI2 antibody

This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq].

Product Categories/Family for anti-TNNI2 antibody

Antibodies; Cardiac Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4507621
• NCBI GeneID: 7136
• NCBI Accession #: NP_003273
• NCBI GenBank Nucleotide #: NM_003282
• UniProt Accession #: P48788
• Molecular Weight: 21kDa
• NCBI Official Full Name: troponin I, fast skeletal muscle isoform 1
• NCBI Official Synonym Full Names: troponin I2, fast skeletal type
• NCBI Official Symbol: TNNI2
• NCBI Official Synonym Symbols: DA2B; FSSV; fsTnI; AMCD2B
• NCBI Protein Information: troponin I, fast skeletal muscle
• UniProt Protein Name: Troponin I, fast skeletal muscle
• Protein Family: Troponin
• UniProt Gene Name: TNNI2
• UniProt Entry Name: TNNI2_HUMAN

NCBI Description

This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

TNNI2: Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Defects in TNNI2 are a cause of distal arthrogryposis type 2B (DA2B); also known as arthrogryposis multiplex congenita, distal, type 2B (AMCD2B). DA2B is a form of inherited multiple congenital contractures. Affected individuals have vertical talus, ulnar deviation in the hands, severe camptodactyly, and a distinctive face characterized by a triangular shape, prominent nasolabial folds, small mouth and a prominent chin. Belongs to the troponin I family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: troponin complex; cytosol; nucleus

Molecular Function: troponin T binding; protein binding; actin binding

Biological Process: skeletal muscle contraction; regulation of muscle contraction; positive regulation of transcription, DNA-dependent; muscle filament sliding

Disease: Arthrogryposis, Distal, Type 2b