Mouse anti-Human SLC39A13 Monoclonal Antibody | anti-SLC39A13 antibody

SLC39A13 (Solute Carrier Family 39 Member 13, LIV-1 Subfamily of ZIP Zinc Transporter 9, LZT-Hs9, Zinc Transporter ZIP13, Zrt- and Irt-like Protein 13, ZIP13, ZIP-13) (Biotin)

Cat. Num. AAA6144434

• Gene Names: SLC39A13; ZIP13; SCDEDS; EDSSPD3; LZT-Hs9
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC39A13; Monoclonal Antibody; SLC39A13 (Solute Carrier Family 39 Member 13; LIV-1 Subfamily of ZIP Zinc Transporter 9; LZT-Hs9; Zinc Transporter ZIP13; Zrt- and Irt-like Protein 13; ZIP13; ZIP-13) (Biotin); anti-SLC39A13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G2
• Specificity: Recognizes human SLC39A13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 364

• Applicable Applications for anti-SLC39A13 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa170-227 from human SLC39A13 (NP_689477) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANT
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Categories/Family for anti-SLC39A13 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 40255101
• NCBI GeneID: 91252
• NCBI Accession #: NP_689477.2
• NCBI GenBank Nucleotide #: NM_152264
• UniProt Accession #: Q96H72
• NCBI Official Full Name: zinc transporter ZIP13 isoform b
• NCBI Official Synonym Full Names: solute carrier family 39 member 13
• NCBI Official Symbol: SLC39A13
• NCBI Official Synonym Symbols: ZIP13; SCDEDS; EDSSPD3; LZT-Hs9
• NCBI Protein Information: zinc transporter ZIP13
• UniProt Protein Name: Zinc transporter ZIP13
• Protein Family: Zinc transporter
• UniProt Gene Name: SLC39A13
• UniProt Synonym Gene Names: ZIP13; LZT-Hs9; ZIP-13
• UniProt Entry Name: S39AD_HUMAN

NCBI Description

This gene encodes a member of the LIV-1 subfamily of the ZIP transporter family. The encoded transmembrane protein functions as a zinc transporter. Mutations in this gene have been associated with the spondylocheiro dysplastic form of Ehlers-Danlos syndrome. Alternate transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

SLC39A13: Acts as a zinc-influx transporter. Defects in SLC39A13 are the cause of Ehlers-Danlos syndrome-like spondylocheirodysplasia (SCD-EDS). SCD- EDS is a 'spondylocheiro dysplastic form of Ehlers-Danlos syndrome'. The syndrome consists of a generalized skeletal dysplasia involving mainly the spine (spondylo) and striking clinical abnormalities of the hands (cheiro) in addition to the EDS-like features. Clinical features included postnatal growth retardation, moderate short stature, protuberant eyes with bluish sclerae, hands with finely wrinkled palms, atrophy of the thenar muscles, and tapering fingers. Patients have thin, hyperelastic skin and hypermobile small joints consistent with an Ehlers- Danlos-like phenotype. Radiologic features included mild to moderate platyspondyly, mild to moderate osteopenia of the spine, small ileum, flat proximal femoral epiphyses, short, wide femoral necks, and broad metaphyses (elbows, knees, wrists, and interphalangeal joints). Belongs to the ZIP transporter (TC 2.A.5) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; integral to membrane; integral to Golgi membrane

Molecular Function: protein homodimerization activity; zinc ion transmembrane transporter activity

Biological Process: cellular zinc ion homeostasis

Disease: Spondylocheirodysplasia, Ehlers-danlos Syndrome-like