Mouse anti-Human Serotonin Receptor 5A Monoclonal Antibody | anti-HTR5A antibody

Serotonin Receptor 5A (5-Hydroxytryptamine 5A Receptor, 5-Hydroxytryptamine Receptor 5A, 5-HT5A, 5-HT-5A, 5HT5A Receptor, 5-HT5A Receptor, 5-HT5AR, HTR5A, MGC138226) (Biotin)

Cat. Num. AAA6144289

• Gene Names: HTR5A; 5-HT5A
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography
• Synonyms: Serotonin Receptor 5A; Monoclonal Antibody; Serotonin Receptor 5A (5-Hydroxytryptamine 5A Receptor; 5-Hydroxytryptamine Receptor 5A; 5-HT5A; 5-HT-5A; 5HT5A Receptor; 5-HT5A Receptor; 5-HT5AR; HTR5A; MGC138226) (Biotin); anti-HTR5A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 10D3
• Specificity: Recognizes human HTR5A.
• Purity/Purification: Purified by Protein A Affinity Chromatography
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-HTR5A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa223-282 from human HTR5A (NP_076917) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.34kD).)

Testing Data

(Detection limit for recombinant GST tagged HTR5A is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-HTR5A antibody

Antibodies; Serotonin Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 13236497
• NCBI GeneID: 3361
• NCBI Accession #: NP_076917
• NCBI GenBank Nucleotide #: NM_024012
• UniProt Accession #: P47898; Q2M2D2
• Molecular Weight: 40,255 Da
• NCBI Official Full Name: 5-hydroxytryptamine receptor 5A
• NCBI Official Synonym Full Names: 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled
• NCBI Official Symbol: HTR5A
• NCBI Official Synonym Symbols: 5-HT5A
• NCBI Protein Information: 5-hydroxytryptamine receptor 5A
• UniProt Protein Name: 5-hydroxytryptamine receptor 5A
• Protein Family: 5-hydroxytryptamine receptor
• UniProt Gene Name: HTR5A
• UniProt Synonym Gene Names: 5-HT-5; 5-HT-5A; 5-HT5A
• UniProt Entry Name: 5HT5A_HUMAN

NCBI Description

The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq, Jul 2008]

Uniprot Description

5-HT(5A): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: Golgi apparatus; rough endoplasmic reticulum; integral to plasma membrane; dendrite; plasma membrane; perikaryon

Molecular Function: serotonin receptor activity

Biological Process: G-protein signaling, coupled to cyclic nucleotide second messenger; G-protein coupled receptor protein signaling pathway; cAMP-mediated signaling; hippocampus development; serotonin receptor signaling pathway; response to estradiol stimulus