Mouse anti-Human RXRB Monoclonal Antibody | anti-RXRB antibody

RXRB (NR2B2, Retinoic Acid Receptor RXR-beta, Nuclear Receptor Subfamily 2 Group B Member 2, Retinoid X Receptor beta, MGC1831) (Biotin)

Cat. Num. AAA6144184

• Gene Names: RXRB; NR2B2; DAUDI6; RCoR-1; H-2RIIBP
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RXRB; Monoclonal Antibody; RXRB (NR2B2; Retinoic Acid Receptor RXR-beta; Nuclear Receptor Subfamily 2 Group B Member 2; Retinoid X Receptor beta; MGC1831) (Biotin); anti-RXRB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3C8
• Specificity: Recognizes human RXRB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RXRB antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa161-260 from human RXRB with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYC
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of RXRB expression in transfected 293T cell line by RXRB monoclonal antibody. Lane 1: RXRB transfected lysate (56.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RXRB antibody

Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. Specifically binds 9-cis retinoic acid (9C-RA).

Product Categories/Family for anti-RXRB antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 12654658
• NCBI GeneID: 6257
• Molecular Weight: 57,365 Da
• NCBI Official Full Name: Homo sapiens retinoid X receptor, beta, mRNA
• NCBI Official Synonym Full Names: retinoid X receptor beta
• NCBI Official Symbol: RXRB
• NCBI Official Synonym Symbols: NR2B2; DAUDI6; RCoR-1; H-2RIIBP
• NCBI Protein Information: retinoic acid receptor RXR-beta
• Protein Family: Retinoic acid receptor

NCBI Description

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]